DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and KDM2B

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:XP_011537169.1 Gene:KDM2B / 84678 HGNCID:13610 Length:1353 Species:Homo sapiens


Alignment Length:361 Identity:71/361 - (19%)
Similarity:114/361 - (31%) Gaps:136/361 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PFADTTIEKLPDKVLLHIFSYLSHREICRLARICRRWRQIAYDTRLWKNVSLRPEVSGLHVGSLE 92
            |..|.....:..:|.:.:||||||:::|...|:||.|.:...|.|||..:.|.            
Human  1059 PLDDGAAHVMHREVWMAVFSYLSHQDLCVCMRVCRTWNRWCCDKRLWTRIDLN------------ 1111

  Fly    93 MLLQLISVRFGPTLRYIELPIELITHTVLHELSAKCPNLTHMLLDFSTAMQLHDFSEMQAFPTKL 157
                                              .|.::|.::|......|          |..|
Human  1112 ----------------------------------HCKSITPLMLSGIIRRQ----------PVSL 1132

  Fly   158 RYMCVCLSEVIFMEGFMRKIYNFINGLEVLHLIGTYEKCEEEEEEIYEVINVHKLKSATPNLRVI 222
            ......:|:        :::...||.|                                |.||.:
Human  1133 DLSWTNISK--------KQLSWLINRL--------------------------------PGLRDL 1157

  Fly   223 NLYGINFIDDSHIDAFSSNCIQLECLAVNFCNKVTGSTLKTLI------------QRSKRLTCLL 275
            .|.|.::|..|.:  .||:|..|..|.|.:...:..:.::.|:            .|||     |
Human  1158 VLSGCSWIAVSAL--CSSSCPLLRTLDVQWVEGLKDAQMRDLLSPPTDNRPGQMDNRSK-----L 1215

  Fly   276 MNGTSLKSEFVMQAEWDKCALQELDITATDLSTECLVDMLSRIPSLKFLSAGQINGFNDSVLKQW 340
            .|...|:             |..||||...|..     ::..:|.|..|.....|...|..:...
Human  1216 RNIVELR-------------LAGLDITDASLRL-----IIRHMPLLSKLHLSYCNHVTDQSINLL 1262

  Fly   341 MESGTTR--SLISLDLDSSDNISDEGLLKFIQRQGH 374
            ...|||.  ||..::|...:.::|: .|.|.:|.|:
Human  1263 TAVGTTTRDSLTEINLSDCNKVTDQ-CLSFFKRCGN 1297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 16/45 (36%)
leucine-rich repeat 131..156 CDD:275381 4/24 (17%)
leucine-rich repeat 157..175 CDD:275381 2/17 (12%)
leucine-rich repeat 219..244 CDD:275381 9/24 (38%)
leucine-rich repeat 245..270 CDD:275381 6/36 (17%)
leucine-rich repeat 271..295 CDD:275381 3/23 (13%)
leucine-rich repeat 296..320 CDD:275381 6/23 (26%)
leucine-rich repeat 321..348 CDD:275381 7/28 (25%)
leucine-rich repeat 349..375 CDD:275381 7/26 (27%)
leucine-rich repeat 376..403 CDD:275381
leucine-rich repeat 405..432 CDD:275381
KDM2BXP_011537169.1 JmjC 182..257 CDD:214721
cupin_like 229..335 CDD:304367
zf-CXXC <615..651 CDD:251032
PHD_KDM2B 661..722 CDD:277114
F-box-like 1071..1111 CDD:289689 16/39 (41%)
leucine-rich repeat 1105..1129 CDD:275381 6/79 (8%)
AMN1 1121..1310 CDD:187754 50/253 (20%)
leucine-rich repeat 1130..1153 CDD:275381 5/62 (8%)
leucine-rich repeat 1154..1177 CDD:275381 9/24 (38%)
leucine-rich repeat 1178..1217 CDD:275381 8/43 (19%)
leucine-rich repeat 1218..1242 CDD:275381 7/41 (17%)
leucine-rich repeat 1243..1272 CDD:275381 7/28 (25%)
leucine-rich repeat 1273..1297 CDD:275381 6/24 (25%)
leucine-rich repeat 1298..1323 CDD:275381 71/361 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.