DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and AT1G52650

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_175674.3 Gene:AT1G52650 / 841697 AraportID:AT1G52650 Length:465 Species:Arabidopsis thaliana


Alignment Length:483 Identity:92/483 - (19%)
Similarity:181/483 - (37%) Gaps:147/483 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IEKLPDKVLLHIFSYLSHREICRLARICRRWRQ-IAYDTRLW--KNVSLRPEVS-----GLHVGS 90
            :..||:.||.:|||:|:.:|....:.:|:|||. :|:...|.  .:|.|.||..     .:....
plant     4 VSSLPEGVLCNIFSFLTTKEAALTSILCKRWRNLLAFVPNLVIDDSVFLHPEEGKEERYEIQQSF 68

  Fly    91 LEMLLQLISVRFGPTLRYIELPIELITHTVLHELSAKCPN-LTHMLLDFSTAMQLHDFSEMQAFP 154
            :|.:.::::::....::...|...  |....|.::|...| |...:.:....:.|:....:...|
plant    69 MEFVDRVLALQGNSPIKKFSLKFR--TDFASHRVNAWISNVLARGVSELDVLVILYGAEFLPLSP 131

  Fly   155 TKLRYMCVCLSEVIFMEGFMRKIYNFINGLEVLHLIGTYEKCEEEEEEIYEVINVHKLKSATPNL 219
                 .|.....::.::         ||.|.:..|.|          :|:           .|.|
plant   132 -----KCFKSRNLVTLK---------INSLGIDWLAG----------DIF-----------LPML 161

  Fly   220 RVINLYGINFIDDSHIDAFSSNCI----QLECLAVNFCNK---VTGSTLKTL-IQRSKRLTCLLM 276
            :.:.|:.:...    :|.|....:    :|...||::.::   |:.:::||| |:.:..|..|.:
plant   162 KTLVLHSVKLC----VDKFFFRALPALEELVLFAVSWRDRDVTVSNASIKTLTIKFNYYLGTLSL 222

  Fly   277 NGTSLK----SEFVMQ----AEWDKCALQELDITATDLSTECLVDMLSRIPSLKFLSAGQINGFN 333
            :..||.    |:.|.:    |:.:|.:...:.:..|:...|     .:|.|::            
plant   223 DTPSLVSFCFSDHVAKDYPLAKMEKLSEARISLLVTEYQIE-----RARAPNI------------ 270

  Fly   334 DSVLKQWMESGTTRSLISLD-----------LDSSDNISDEGLLKFIQRQGHQLSACCLSGMPHI 387
                 .|:|......|:::.           |:.|.|..:            .||.||.|     
plant   271 -----YWVEDDVVLRLVNVGKLMKGIRNVQYLNLSPNTLE------------VLSKCCES----- 313

  Fly   388 TDQLWMSILPLLGNCKIIVMGTAEKLGVNIHVDQLMDTIASNCGNLERLELRWDPDNL--RFSDK 450
                    :||..|.|.:.:.:.|:.|.     |.|..:..||.:||.|.|    :.|  ..::|
plant   314 --------MPLFNNLKSLTIESNERRGW-----QAMPVLLRNCPHLETLVL----EGLLHHVTEK 361

  Fly   451 SQKAIDIL------------RVKCLKLR 466
            .:.|.|.:            :||.|:::
plant   362 CRNACDCVSQEEKGRSLTSCQVKVLEIK 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 16/48 (33%)
leucine-rich repeat 131..156 CDD:275381 3/24 (13%)
leucine-rich repeat 157..175 CDD:275381 1/17 (6%)
leucine-rich repeat 219..244 CDD:275381 4/28 (14%)
leucine-rich repeat 245..270 CDD:275381 8/28 (29%)
leucine-rich repeat 271..295 CDD:275381 8/31 (26%)
leucine-rich repeat 296..320 CDD:275381 3/23 (13%)
leucine-rich repeat 321..348 CDD:275381 2/26 (8%)
leucine-rich repeat 349..375 CDD:275381 4/36 (11%)
leucine-rich repeat 376..403 CDD:275381 8/26 (31%)
leucine-rich repeat 405..432 CDD:275381 6/26 (23%)
AT1G52650NP_175674.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.