DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and AT5G21900

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_680178.1 Gene:AT5G21900 / 832250 AraportID:AT5G21900 Length:544 Species:Arabidopsis thaliana


Alignment Length:492 Identity:98/492 - (19%)
Similarity:173/492 - (35%) Gaps:160/492 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 RPEVSGLHVGSLEMLLQLISVRFGPTLRYIELPIELITHTVLHELSAK-CPNLTHMLLDFSTAMQ 143
            |.|:|    .:.:|.:.|...|..|:|  :||...::....|...|.| .|:.....|.:..   
plant   124 RQEIS----TTSDMEIDLNVRRKAPSL--VELSARVLAQNFLAIKSLKLVPDHLRKKLSYLV--- 179

  Fly   144 LHDFSEMQAFPTKLRYMC-------VCLSEVI-FMEGFMRKIYNFIN--GLEVLHLIGTYEKCEE 198
                |.:..|.|:|..:.       :|....: .:|..:.||:...:  .|:||.|    :.|..
plant   180 ----SGLGEFDTRLMELLIEDSPSEICAKNCVQLVEDDLVKIFCDCDRVSLKVLIL----DLCGR 236

  Fly   199 EEEEIYEVINVHK-LKSATPNLRVINLYGINFIDDSHIDAFSSNCIQLECLAVNFCNKVT----- 257
            ...: |.:....| ..:..|:|..::|.|...:.|:.:...|.:...|:.:.:..|:.:|     
plant   237 SMTD-YTINQFFKRAPNGFPSLTTLSLQGAFCLTDNALLLISKSSPLLQYINLTECSLLTYRALR 300

  Fly   258 ------GSTLKTL-------IQRSKRLTCLL----------------MNGTSLKSEFVMQAE--- 290
                  ||||:.|       |::.|..:..|                :|...::|.|:.::.   
plant   301 ILADKFGSTLRGLSIGGCQGIKKHKGFSSSLYKFEKLNYLSVAGLVSVNDGVVRSFFMFRSSILT 365

  Fly   291 ----------WDKC---------ALQELDITATDLSTECLVDMLSRIPSLKFLSAGQINGFNDSV 336
                      .|:|         .|:.||||..|..|:         .||:|::.|         
plant   366 DLSLANCNEVTDECMWHIGRYCKKLEALDITDLDKLTD---------KSLEFITEG--------- 412

  Fly   337 LKQWMESGTTRSLISLDLDSSDNISDEGLLKFIQRQGHQLSACCLSGMPHITDQLWMSILPLLGN 401
                     .|.|.||.| :|:..|||.:..|::..|..|...||:.:..:..:...|:..:   
plant   413 ---------CRYLKSLKL-TSNRFSDECIAAFLEVSGGSLRELCLNKVRDVGPETAFSLAKV--- 464

  Fly   402 CKIIVMGTAEKLGVNIHVDQLMD-------------TIASNCGNLERLEL-RWDP------DNLR 446
            ||::               |.:|             .|...|.:|:.|:| .|..      :.|.
plant   465 CKML---------------QFLDLSWCRRLKEDDLRRILRCCSSLQSLKLFGWTQVEDTYLEELS 514

  Fly   447 FSDKSQKAIDILRVKCLKLRCMVLSDGRYYETVKANF 483
            .||        :.:..|||..:......:|.:|.|.|
plant   515 RSD--------VHITGLKLTSLYAHLDNFYPSVGAKF 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 98/492 (20%)
leucine-rich repeat 131..156 CDD:275381 3/24 (13%)
leucine-rich repeat 157..175 CDD:275381 3/25 (12%)
leucine-rich repeat 219..244 CDD:275381 5/24 (21%)
leucine-rich repeat 245..270 CDD:275381 9/42 (21%)
leucine-rich repeat 271..295 CDD:275381 6/61 (10%)
leucine-rich repeat 296..320 CDD:275381 7/23 (30%)
leucine-rich repeat 321..348 CDD:275381 3/26 (12%)
leucine-rich repeat 349..375 CDD:275381 10/25 (40%)
leucine-rich repeat 376..403 CDD:275381 4/26 (15%)
leucine-rich repeat 405..432 CDD:275381 4/39 (10%)
AT5G21900NP_680178.1 AMN1 221..405 CDD:187754 36/197 (18%)
leucine-rich repeat 228..244 CDD:275381 5/20 (25%)
leucine-rich repeat 257..282 CDD:275381 5/24 (21%)
leucine-rich repeat 283..309 CDD:275381 4/25 (16%)
leucine-rich repeat 310..354 CDD:275381 6/43 (14%)
AMN1 <357..507 CDD:187754 39/195 (20%)
leucine-rich repeat 364..389 CDD:275381 2/24 (8%)
leucine-rich repeat 390..415 CDD:275381 11/51 (22%)
leucine-rich repeat 416..441 CDD:275381 10/25 (40%)
leucine-rich repeat 442..467 CDD:275381 5/27 (19%)
leucine-rich repeat 468..493 CDD:275381 4/39 (10%)
leucine-rich repeat 494..516 CDD:275381 5/21 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.