DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and AT2G06040

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_178661.2 Gene:AT2G06040 / 815159 AraportID:AT2G06040 Length:762 Species:Arabidopsis thaliana


Alignment Length:467 Identity:98/467 - (20%)
Similarity:178/467 - (38%) Gaps:138/467 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LW---KNVSLRP-EVSGLHVGSLEMLLQ----LISVRFGP-TLRYIELPIELITHTVLHELSAKC 128
            :|   .|.|..| :...|...||.:|::    :.|:.:.| |||.                    
plant   357 IWVPRSNFSFPPRKAPSLQELSLRVLVKNADAITSLDYVPDTLRV-------------------- 401

  Fly   129 PNLTHMLLDFSTAMQLHDFSEM--QAFPTKLRYMCV--C--LSEVIFMEGFMRKIYNFINGLEVL 187
             .|..:|.| |..|.|| |.::  |..||::   ||  |  |:|..|.|.|  |..:..| |.||
plant   402 -KLCQLLCD-SRRMDLH-FLDLLVQGSPTEI---CVPDCSWLTEEEFTECF--KNCDTSN-LMVL 457

  Fly   188 HLIGTYEKCEEEEEEIYEVINVHKLKSATPNLRVINLYGINFIDDSHIDAFSSNCIQLECLAVNF 252
            .|    ::|.....:......:.:.....|.|..:::.|...:.|..:....|:...:..:.:|.
plant   458 QL----DQCGRCMPDYILPFTLARSPKVLPMLSTLSISGACRLSDVGLRQLVSSAPAITSINLNQ 518

  Fly   253 CNKVTGSTLKTLIQRSKRLTCLLMNGTSLKSEFVMQAEWDKCALQELDITATDLSTECLVDMLSR 317
            |:.:|.|::..|   |..|      |:.|:..::     ::|  |.:|:       :.::..|.:
plant   519 CSLLTSSSIDML---SDSL------GSVLRELYI-----NEC--QNIDM-------KHILAALKK 560

  Fly   318 IPSLKFLSAGQINGFNDSVLKQWMESGTTRSLISLDLDSSDNISDEGLLKFIQRQGHQLSACCLS 382
            ...|:.||...:.......||::: :...::|..|.|.:|..:||..:        ..:|..|  
plant   561 FEKLEVLSLADLPSVKGRFLKEFV-TARGQTLKQLILTNSRKLSDSSI--------KVISENC-- 614

  Fly   383 GMPHITDQLWMSILPLLGNCKIIVMGTAEKLGVNIHVDQLMDTIASNCGNLERLELRWDPDNLRF 447
              |:      :|:|.|...||:              .|..:..:|:.|..||:|....:|    |
plant   615 --PN------LSVLDLANVCKL--------------TDSSLGYLANGCQALEKLIFCRNP----F 653

  Fly   448 SDK-----------SQKAIDILRVKCLKLRCMVLSDGRYYETVKANFERADRITVVRTTTCCRVS 501
            ||:           |.|.:.:..||.:.           :.|..|..:.:|::.::..:.|..:|
plant   654 SDEAVAAFVETAGGSLKELSLNNVKKVG-----------HNTALALAKHSDKLQILDISWCREMS 707

  Fly   502 PYHLLRNYNDLI 513
                    |||:
plant   708 --------NDLL 711

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 3/9 (33%)
leucine-rich repeat 131..156 CDD:275381 10/26 (38%)
leucine-rich repeat 157..175 CDD:275381 8/21 (38%)
leucine-rich repeat 219..244 CDD:275381 4/24 (17%)
leucine-rich repeat 245..270 CDD:275381 6/24 (25%)
leucine-rich repeat 271..295 CDD:275381 3/23 (13%)
leucine-rich repeat 296..320 CDD:275381 3/23 (13%)
leucine-rich repeat 321..348 CDD:275381 5/26 (19%)
leucine-rich repeat 349..375 CDD:275381 6/25 (24%)
leucine-rich repeat 376..403 CDD:275381 6/26 (23%)
leucine-rich repeat 405..432 CDD:275381 3/26 (12%)
AT2G06040NP_178661.2 leucine-rich repeat 427..453 CDD:275381 10/30 (33%)
AMN1 446..632 CDD:187754 46/248 (19%)
leucine-rich repeat 454..484 CDD:275381 5/33 (15%)
leucine-rich repeat 485..510 CDD:275381 4/24 (17%)
leucine-rich repeat 511..527 CDD:275381 4/15 (27%)
leucine-rich repeat 538..563 CDD:275381 5/38 (13%)
leucine-rich repeat 564..590 CDD:275381 5/26 (19%)
leucine-rich repeat 591..616 CDD:275381 8/36 (22%)
leucine-rich repeat 617..642 CDD:275381 8/38 (21%)
leucine-rich repeat 643..668 CDD:275381 7/28 (25%)
leucine-rich repeat 669..694 CDD:275381 5/35 (14%)
leucine-rich repeat 695..720 CDD:275381 5/25 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.