DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and fbxl17

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:XP_001335097.5 Gene:fbxl17 / 795023 ZFINID:ZDB-GENE-111013-3 Length:409 Species:Danio rerio


Alignment Length:256 Identity:58/256 - (22%)
Similarity:98/256 - (38%) Gaps:69/256 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DTT-IEKLPDKVLLHIFSYLSHREICRLAR-ICRRWRQIAYDTRLWKNVSLRPEVSGLHVGSLEM 93
            ||: |.:||..:||.:||:||.:|.|..|. :|:.||.:..|.:.||.:.|    |||.....::
Zfish   217 DTSHINQLPSSILLKVFSHLSVKERCLAASLVCKYWRDLCLDFQFWKQIDL----SGLQQVKDDL 277

  Fly    94 LLQLISVRFGPTLRYIELPIELITHTVLHELSAKCPNLTHMLLDFSTAMQLHDFSEMQAFPTKLR 158
            |:::.|.|...|    |:.|....:...|.:.|...|...::.  .||.:....|:         
Zfish   278 LVKIASRRQNVT----EINISDCRNVQDHGVCALASNCAGLIK--YTAYRCKQLSD--------- 327

  Fly   159 YMCVCLSEVIFMEGFMRKIYNFINGLEVLHLIGTYEKCEEEEEEIYEVINVHKLKSATPNLRVIN 223
               |.||.|......::|::           :|..:|..:           |.||          
Zfish   328 ---VSLSTVAIHCPLLQKVH-----------VGNQDKLTD-----------HALK---------- 357

  Fly   224 LYGINFIDDSHIDAFSSNCIQLECLAVNFCNKVTGSTLKTLIQRSKRLTCLLMNGTSLKSE 284
            |.|             .:|.:|:.:....|..::...|.:|.|...:|..:.|....|.|:
Zfish   358 LLG-------------DHCKELKDVHFGQCYSISDEGLMSLAQGCNKLQRIYMQENKLVSQ 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 18/46 (39%)
leucine-rich repeat 131..156 CDD:275381 3/24 (13%)
leucine-rich repeat 157..175 CDD:275381 4/17 (24%)
leucine-rich repeat 219..244 CDD:275381 3/24 (13%)
leucine-rich repeat 245..270 CDD:275381 5/24 (21%)
leucine-rich repeat 271..295 CDD:275381 4/14 (29%)
leucine-rich repeat 296..320 CDD:275381
leucine-rich repeat 321..348 CDD:275381
leucine-rich repeat 349..375 CDD:275381
leucine-rich repeat 376..403 CDD:275381
leucine-rich repeat 405..432 CDD:275381
fbxl17XP_001335097.5 F-box-like 221..268 CDD:289689 19/50 (38%)
AMN1 257..>397 CDD:187754 38/206 (18%)
leucine-rich repeat 262..287 CDD:275381 9/28 (32%)
leucine-rich repeat 288..313 CDD:275381 6/28 (21%)
leucine-rich repeat 314..339 CDD:275381 7/38 (18%)
leucine-rich repeat 340..365 CDD:275381 9/69 (13%)
leucine-rich repeat 366..391 CDD:275381 5/24 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588059
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.