DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and FBXL15

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:XP_005270206.1 Gene:FBXL15 / 79176 HGNCID:28155 Length:387 Species:Homo sapiens


Alignment Length:371 Identity:70/371 - (18%)
Similarity:118/371 - (31%) Gaps:149/371 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 LRYIELPIE--LITHTVLHELSAKCPNLTHMLLDFSTAMQLH-----DFSEMQAFPTKLRYMCVC 163
            :|:::||.|  |:.|.:......:...|..:...|.:.:|||     .|...|..|...|     
Human   104 VRFLDLPWEDVLLPHVLNRVPLRQLLRLQRVSRAFRSLVQLHLAGLRRFDAAQVGPQIPR----- 163

  Fly   164 LSEVIFMEGFMRKIYNFINGLEVLHLIGTYEKCEE--EEEEIYEVINVHKLKSATPNLRVINLYG 226
                    ..:.::.....||:.|.|    ..|.|  .:|::..|:      :..|.||.:.|.|
Human   164 --------AALARLLRDAEGLQELAL----APCHEWLSDEDLVPVL------ARNPQLRSVALGG 210

  Fly   227 INFIDDSHIDAFSSNCIQLECLAVNFCNKVTGSTLKTLIQRSKRLTCLLMNGTSLKSEFVMQAEW 291
            ...:....:.|.:..|.:|:.|::..|:.|.|..|:.|.                          
Human   211 CGQLSRRALGALAEGCPRLQRLSLAHCDWVDGLALRGLA-------------------------- 249

  Fly   292 DKC-ALQELDITATDLSTECLVDMLSRIPSLKFLSAGQINGFNDSVLKQWMESGTTRSLISLDLD 355
            |:| ||:|||:||      |                                             
Human   250 DRCPALEELDLTA------C--------------------------------------------- 263

  Fly   356 SSDNISDEGLLKFIQRQGHQLSACCLSGMPHITDQLWMSILPLLGNCKIIVMGTAEKLGVNIHV- 419
              ..:.||.::...||:|        :|:..::                        |.||.:| 
Human   264 --RQLKDEAIVYLAQRRG--------AGLRSLS------------------------LAVNANVG 294

  Fly   420 DQLMDTIASNCGNLERLE----LRWDPDNLRFSDKSQKAIDILRVK 461
            |..:..:|.||..|..|:    ||...|.:|...:....:..|||:
Human   295 DAAVQELARNCPELHHLDLTGCLRVGSDGVRTLAEYCPVLRSLRVR 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689
leucine-rich repeat 131..156 CDD:275381 8/29 (28%)
leucine-rich repeat 157..175 CDD:275381 1/17 (6%)
leucine-rich repeat 219..244 CDD:275381 6/24 (25%)
leucine-rich repeat 245..270 CDD:275381 7/24 (29%)
leucine-rich repeat 271..295 CDD:275381 2/24 (8%)
leucine-rich repeat 296..320 CDD:275381 7/23 (30%)
leucine-rich repeat 321..348 CDD:275381 0/26 (0%)
leucine-rich repeat 349..375 CDD:275381 5/25 (20%)
leucine-rich repeat 376..403 CDD:275381 1/26 (4%)
leucine-rich repeat 405..432 CDD:275381 8/27 (30%)
FBXL15XP_005270206.1 F-box 105..>142 CDD:279040 8/36 (22%)
leucine-rich repeat 149..175 CDD:275381 4/38 (11%)
leucine-rich repeat 176..202 CDD:275381 7/35 (20%)
leucine-rich repeat 203..228 CDD:275381 6/24 (25%)
AMN1 <226..>353 CDD:187754 41/226 (18%)
leucine-rich repeat 229..254 CDD:275381 9/50 (18%)
leucine-rich repeat 255..281 CDD:275381 12/86 (14%)
leucine-rich repeat 282..307 CDD:275381 8/48 (17%)
leucine-rich repeat 308..332 CDD:275381 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153057
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.