Sequence 1: | NP_733291.1 | Gene: | FipoQ / 43475 | FlyBaseID: | FBgn0039667 | Length: | 515 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_780415.1 | Gene: | Fbxl22 / 74165 | MGIID: | 1921415 | Length: | 236 | Species: | Mus musculus |
Alignment Length: | 243 | Identity: | 51/243 - (20%) |
---|---|---|---|
Similarity: | 78/243 - (32%) | Gaps: | 76/243 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 IEKLPDKVLLHIFSYLSHREICRLARICRRWRQIAYDTRLWKNVSLRPEVSGLHVGSLEMLLQLI 98
Fly 99 SVRFGPTLRYIELPIELITHTVLHELSAKCPNLTHMLLDFSTAMQLHDFSEMQAFPTKLRYMCVC 163
Fly 164 LSEVIFMEGFMRKIYNFINGLEVLHLIGTYEKCEEEEEEIYEVINVHKLK--SATPNLRVINLYG 226
Fly 227 INFIDDSHIDAFSSNCIQLECLAVNFCNKVTGSTLKTLIQRSKRLTCL 274 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
FipoQ | NP_733291.1 | F-box-like | 34..80 | CDD:289689 | 14/45 (31%) |
leucine-rich repeat | 131..156 | CDD:275381 | 2/24 (8%) | ||
leucine-rich repeat | 157..175 | CDD:275381 | 3/17 (18%) | ||
leucine-rich repeat | 219..244 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 245..270 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 271..295 | CDD:275381 | 2/4 (50%) | ||
leucine-rich repeat | 296..320 | CDD:275381 | |||
leucine-rich repeat | 321..348 | CDD:275381 | |||
leucine-rich repeat | 349..375 | CDD:275381 | |||
leucine-rich repeat | 376..403 | CDD:275381 | |||
leucine-rich repeat | 405..432 | CDD:275381 | |||
Fbxl22 | NP_780415.1 | F-box-like | 3..43 | CDD:403981 | 12/39 (31%) |
LRR 1 | 15..40 | 7/24 (29%) | |||
LRR 2 | 43..72 | 10/42 (24%) | |||
AMN1 | 45..>200 | CDD:187754 | 37/201 (18%) | ||
LRR 3 | 98..123 | 7/28 (25%) | |||
leucine-rich repeat | 116..141 | CDD:275381 | 5/24 (21%) | ||
LRR 4 | 124..149 | 4/24 (17%) | |||
leucine-rich repeat | 142..167 | CDD:275381 | 7/24 (29%) | ||
LRR 5 | 150..175 | 7/22 (32%) | |||
leucine-rich repeat | 168..193 | CDD:275381 | 2/4 (50%) | ||
LRR 6 | 176..201 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167843092 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.830 |