DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and Fbxl22

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_780415.1 Gene:Fbxl22 / 74165 MGIID:1921415 Length:236 Species:Mus musculus


Alignment Length:243 Identity:51/243 - (20%)
Similarity:78/243 - (32%) Gaps:76/243 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IEKLPDKVLLHIFSYLSHREICRLARICRRWRQIAYDTRLWKNVSLRPEVSGLHVGSLEMLLQLI 98
            |.:|..:.||.:||:|.......|:|.|.:.|.:..|..||..         ||..||.. |:..
Mouse     3 ITQLNRECLLCLFSFLDKDSRRSLSRTCSQLRDVFEDPTLWPL---------LHFHSLAE-LKKD 57

  Fly    99 SVRFGPTLRYIELPIELITHTVLHELSAKCPNLTHMLLDFSTAMQLHDFSEMQAFPTKLRYMCVC 163
            :.|..|.||    .:.:..|:                            |.:|          ||
Mouse    58 NFRLSPALR----SLSICWHS----------------------------SRVQ----------VC 80

  Fly   164 LSEVIFMEGFMRKIYNFINGLEVLHLIGTYEKCEEEEEEIYEVINVHKLK--SATPNLRVINLYG 226
            ..|........|.|                  |.:.|    .::|...|:  :..|||..:.|.|
Mouse    81 SIEDWLKSALQRSI------------------CSQHE----SLVNDFLLQVCNRCPNLTSVTLSG 123

  Fly   227 INFIDDSHIDAFSSNCIQLECLAVNFCNKVTGSTLKTLIQRSKRLTCL 274
            ...:.|..:.....:|.:|..|.:..|.:||..||..:....:.|..|
Mouse   124 CGHVTDDCLARLLLSCPRLRTLRLENCARVTNRTLAAVAAHGRALQTL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 14/45 (31%)
leucine-rich repeat 131..156 CDD:275381 2/24 (8%)
leucine-rich repeat 157..175 CDD:275381 3/17 (18%)
leucine-rich repeat 219..244 CDD:275381 5/24 (21%)
leucine-rich repeat 245..270 CDD:275381 7/24 (29%)
leucine-rich repeat 271..295 CDD:275381 2/4 (50%)
leucine-rich repeat 296..320 CDD:275381
leucine-rich repeat 321..348 CDD:275381
leucine-rich repeat 349..375 CDD:275381
leucine-rich repeat 376..403 CDD:275381
leucine-rich repeat 405..432 CDD:275381
Fbxl22NP_780415.1 F-box-like 3..43 CDD:403981 12/39 (31%)
LRR 1 15..40 7/24 (29%)
LRR 2 43..72 10/42 (24%)
AMN1 45..>200 CDD:187754 37/201 (18%)
LRR 3 98..123 7/28 (25%)
leucine-rich repeat 116..141 CDD:275381 5/24 (21%)
LRR 4 124..149 4/24 (17%)
leucine-rich repeat 142..167 CDD:275381 7/24 (29%)
LRR 5 150..175 7/22 (32%)
leucine-rich repeat 168..193 CDD:275381 2/4 (50%)
LRR 6 176..201
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843092
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.