DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and Fbxl15

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001365702.1 Gene:Fbxl15 / 68431 MGIID:1915681 Length:336 Species:Mus musculus


Alignment Length:441 Identity:83/441 - (18%)
Similarity:134/441 - (30%) Gaps:189/441 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LP--DKVLLHIFSYLSHREICRLARICRRWRQIAYDTRLWKNVSLRPEVSGLHVGSLEMLLQLIS 99
            ||  |.:|.|:.:::..|::.||.|:.|.:|.:..                ||:..|.. .....
Mouse    22 LPWEDVLLPHVLNWVPLRQLLRLQRVSRAFRALVQ----------------LHLARLRR-FDAAQ 69

  Fly   100 VRFGPTLRYIELPIELITHTVLHELSAKC------PNLTHMLLDFSTAMQLHDFSEMQAFPTKLR 158
            |..||..|....|..:.....| :.|..|      |.:...:...:.|..|.|            
Mouse    70 VSRGPEPRPRHAPAWVPPSPRL-QASPCCAVNPSRPRVGPQIPRAALARLLRD------------ 121

  Fly   159 YMCVCLSEVIFMEGFMRKIYNFINGLEVLHLIGTYEKCEE--EEEEIYEVINVHKLKSATPNLRV 221
                                  ..||:.|.|    ..|.|  .:|::..|:      :..|.||.
Mouse   122 ----------------------AEGLQELAL----APCHEWLSDEDLVPVL------ARNPQLRS 154

  Fly   222 INLYGINFIDDSHIDAFSSNCIQLECLAVNFCNKVTGSTLKTLIQRSKRLTCLLMNGTSLKSEFV 286
            :.|.|...:....:.|.:..|.:|:.|::..|:.|.|..|:.|.                     
Mouse   155 VALAGCGQLSRRALGALAEGCPRLQRLSLAHCDWVDGLALRGLA--------------------- 198

  Fly   287 MQAEWDKC-ALQELDITATDLSTECLVDMLSRIPSLKFLSAGQINGFNDSVLKQWMESGTTRSLI 350
                 |:| ||:|||:||      |                                        
Mouse   199 -----DRCPALEELDLTA------C---------------------------------------- 212

  Fly   351 SLDLDSSDNISDEGLLKFIQRQGHQLSACCLSGMPHITDQLWMSILPLLGNCKIIVMGTAEKLGV 415
                   ..:.||.::...||:|        :|:..::                        |.|
Mouse   213 -------RQLKDEAIVYLAQRRG--------AGLRSLS------------------------LAV 238

  Fly   416 NIHV-DQLMDTIASNCGNLERLE----LRWDPDNLRFSDKSQKAIDILRVK 461
            |.:| |..:..:|.||..||.|:    ||...|.:|...:...|:..|||:
Mouse   239 NANVGDTAVQELARNCPQLEHLDLTGCLRVGSDGVRTLAEYCPALRSLRVR 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 11/44 (25%)
leucine-rich repeat 131..156 CDD:275381 3/24 (13%)
leucine-rich repeat 157..175 CDD:275381 0/17 (0%)
leucine-rich repeat 219..244 CDD:275381 6/24 (25%)
leucine-rich repeat 245..270 CDD:275381 7/24 (29%)
leucine-rich repeat 271..295 CDD:275381 2/24 (8%)
leucine-rich repeat 296..320 CDD:275381 7/23 (30%)
leucine-rich repeat 321..348 CDD:275381 0/26 (0%)
leucine-rich repeat 349..375 CDD:275381 5/25 (20%)
leucine-rich repeat 376..403 CDD:275381 1/26 (4%)
leucine-rich repeat 405..432 CDD:275381 8/27 (30%)
Fbxl15NP_001365702.1 F-box 18..55 CDD:395521 11/32 (34%)
leucine-rich repeat 125..151 CDD:275381 7/35 (20%)
leucine-rich repeat 152..177 CDD:275381 6/24 (25%)
AMN1 <175..>304 CDD:187754 43/226 (19%)
leucine-rich repeat 178..203 CDD:275381 9/50 (18%)
leucine-rich repeat 204..230 CDD:275381 12/86 (14%)
leucine-rich repeat 231..256 CDD:275381 8/48 (17%)
leucine-rich repeat 257..281 CDD:275381 7/23 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843156
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.