DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and Fbxl18

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:XP_006248969.1 Gene:Fbxl18 / 678726 RGDID:1596958 Length:707 Species:Rattus norvegicus


Alignment Length:445 Identity:90/445 - (20%)
Similarity:162/445 - (36%) Gaps:116/445 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DTTIEKLPDKVLLHIFSYLSHRE-ICRLARICRRWRQIAYDTRLWKNVSLRPEVSGLHVGSLEML 94
            ||.:....|::||||.|::...: :..:.|.||:...:..|..|...|.|:.:    :..|.|.:
  Rat    14 DTHLLGFSDEILLHILSHVPSTDLVLNVRRTCRKLAALCLDKSLVHTVLLQKD----YQASEEKV 74

  Fly    95 LQLISVRFGPTLRYIE------LPIELITHTVLHELSAKCPNLTHMLLD--FSTAMQLHDFSEMQ 151
            .||:. ..|..::.:.      ||...|.|.      |:|.:|..:.|.  ..|:::|   |.:.
  Rat    75 KQLVK-EIGREIQQLNMAGCYWLPGSTIEHV------ARCHSLVKVNLSGCHLTSLRL---SRVL 129

  Fly   152 AFPTKLRYMCVCLSEVIFMEGFMRKIYNFINGLEVLHLIGTYEKCEEEEEEIYEVINVHKLKSAT 216
            :...:||.:.:.:|.                |.:...|   ..:|:.....:.|:    |....|
  Rat   130 SCLQRLRSLAIDVSP----------------GFDASQL---SSECKATLSRVQEL----KQTLFT 171

  Fly   217 PNLRVINLYGINFIDDSHIDAFSSNCIQLECLAVNFCNKVTGSTLKTLIQRSKR---LTCLLMNG 278
            |:..|:..                 |..|:.|.:.|          .::.|::.   |:..||.|
  Rat   172 PSYGVVPC-----------------CASLQKLLLYF----------EILDRTREGAVLSGQLMVG 209

  Fly   279 TSLKSEFV-MQAEWDKCALQELDITATDLSTECLVDMLSRIPSLKFLSAGQINGFNDSVLKQWME 342
            .|....:. ::..:.:.|...::.....|....|.|   |.|.       .::.|..||...:.|
  Rat   210 QSNVPHYQNLRVFYARLAPGYINQEVVRLYLAVLSD---RTPE-------NLHAFLISVPGSFAE 264

  Fly   343 SGTTRSLISLDLDS-SDNISDEGL---------------LKFIQRQGHQLSACCLSGMPHITDQL 391
            ||.|::|    ||| :.|::.:.|               :||........|.|.||| .|:..:|
  Rat   265 SGATKNL----LDSMARNVALDALQLPKSWLNGSTLLQHMKFNNPFYFSFSRCTLSG-GHLIQRL 324

  Fly   392 WMSILPLLGNCKIIVMGTAEKLGVNI-------HVD-QLMDTIASNCGNLERLEL 438
            ......|.....:.:.|....|..:.       .:| .:::|:..:|.||..|.|
  Rat   325 INGGKDLRSLASLNLSGCVHCLSADSLLRKAEDDIDSSILETLVESCCNLHHLNL 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 12/46 (26%)
leucine-rich repeat 131..156 CDD:275381 5/26 (19%)
leucine-rich repeat 157..175 CDD:275381 3/17 (18%)
leucine-rich repeat 219..244 CDD:275381 2/24 (8%)
leucine-rich repeat 245..270 CDD:275381 4/24 (17%)
leucine-rich repeat 271..295 CDD:275381 5/24 (21%)
leucine-rich repeat 296..320 CDD:275381 4/23 (17%)
leucine-rich repeat 321..348 CDD:275381 7/26 (27%)
leucine-rich repeat 349..375 CDD:275381 8/41 (20%)
leucine-rich repeat 376..403 CDD:275381 8/26 (31%)
leucine-rich repeat 405..432 CDD:275381 5/34 (15%)
Fbxl18XP_006248969.1 F-box-like 22..64 CDD:289689 12/41 (29%)
leucine-rich repeat 334..373 CDD:275381 5/38 (13%)
leucine-rich repeat 374..403 CDD:275381 3/6 (50%)
leucine-rich repeat 404..473 CDD:275381
leucine-rich repeat 522..548 CDD:275381
leucine-rich repeat 549..578 CDD:275381
leucine-rich repeat 579..604 CDD:275381
leucine-rich repeat 605..629 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346607
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.