DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and Fbxl20

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:XP_017453008.1 Gene:Fbxl20 / 64039 RGDID:621722 Length:453 Species:Rattus norvegicus


Alignment Length:456 Identity:102/456 - (22%)
Similarity:170/456 - (37%) Gaps:159/456 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 EKLPDKVLLHIFSYLSHREICRLARICRRWRQIAYDTRLWKNVSL---RPEVSGLHVGSLEMLLQ 96
            :|||.::||.|||:|....:||.|::.|.|..:|.|...|:.:.|   :.::.|           
  Rat    43 KKLPKELLLRIFSFLDVVTLCRCAQVSRAWNVLALDGSNWQRIDLFDFQRDIEG----------- 96

  Fly    97 LISVRFGPTLRYIELPIELITHTVLHELSAKCPNLTHMLLDFSTAMQLHDFSEMQAFPTKLRYMC 161
                                  .|:..:|.:|                                 
  Rat    97 ----------------------RVVENISKRC--------------------------------- 106

  Fly   162 VCLSEVIFMEGFMRKIYNFINGLEVLHLIGTYEKCEEEEEEIYEVINVHKLKSATPNLRVINLYG 226
                     .||:||                                             ::|.|
  Rat   107 ---------GGFLRK---------------------------------------------LSLRG 117

  Fly   227 INFIDDSHIDAFSSNCIQLECLAVNFCNKVTGSTLKTLIQRSKRL------TCLLMNGTSLKSEF 285
            ...:.|:.:..|:.||..:|.|::|.|.|.|.:|..:|.:...:|      :|..:...|||   
  Rat   118 CLGVGDNALRTFAQNCRNIEVLSLNGCTKTTDATCTSLSKFCSKLRHLDLASCTSITNMSLK--- 179

  Fly   286 VMQAEWDKC-ALQELDITATDLSTECLVDMLSR-IPSLKFLSAGQINGFNDSVLKQWMESGTTRS 348
               |..:.| .|::|:|:..|..|:..:..|.| ...||.|.........|..||  ........
  Rat   180 ---ALSEGCPLLEQLNISWCDQVTKDGIQALVRGCGGLKALFLKGCTQLEDEALK--YIGAHCPE 239

  Fly   349 LISLDLDSSDNISDEGLLKFIQRQGHQLSACCLSGMPHITDQLWMSILPLLG-NC---KIIVMGT 409
            |::|:|.:...|:||||:. |.|..|:|.:.|.||..:|||    :||..|| ||   :|:.:..
  Rat   240 LVTLNLQTCLQITDEGLIT-ICRGCHKLQSLCASGCSNITD----AILNALGQNCPRLRILEVAR 299

  Fly   410 AEKLGVNIHVDQLMDTIASNCGNLERLELRWDPDNLRFSDKS--QKAIDILRVKCLKL-RCMVLS 471
            ..:|     .|....|:|.||..||:::|.   :.::.:|.:  |.:|...|::.|.| .|.:::
  Rat   300 CSQL-----TDVGFTTLARNCHELEKMDLE---ECVQITDSTLIQLSIHCPRLQVLSLSHCELIT 356

  Fly   472 D 472
            |
  Rat   357 D 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 18/47 (38%)
leucine-rich repeat 131..156 CDD:275381 0/24 (0%)
leucine-rich repeat 157..175 CDD:275381 2/17 (12%)
leucine-rich repeat 219..244 CDD:275381 6/24 (25%)
leucine-rich repeat 245..270 CDD:275381 8/24 (33%)
leucine-rich repeat 271..295 CDD:275381 7/30 (23%)
leucine-rich repeat 296..320 CDD:275381 7/24 (29%)
leucine-rich repeat 321..348 CDD:275381 6/26 (23%)
leucine-rich repeat 349..375 CDD:275381 10/25 (40%)
leucine-rich repeat 376..403 CDD:275381 13/30 (43%)
leucine-rich repeat 405..432 CDD:275381 6/26 (23%)
Fbxl20XP_017453008.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346643
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.