DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and fbxl3

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001016128.1 Gene:fbxl3 / 548882 XenbaseID:XB-GENE-1014531 Length:433 Species:Xenopus tropicalis


Alignment Length:441 Identity:77/441 - (17%)
Similarity:160/441 - (36%) Gaps:91/441 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LPDKVLLHIFSYLSHREICRLARICRRWRQIAYDTRLWKNVSL---RPEVSGLHVGSLEMLLQLI 98
            ||| ::|.||.||...:....:::||.|..:.:...||:....   :|..|.|:....:::.|:|
 Frog    45 LPD-IILQIFQYLPLLDRAHASQVCRNWNHVFHMPDLWRCFEFELNQPATSYLNATHPDLIKQII 108

  Fly    99 SVRFGPTLRYIELPIELITHTVLHELSAKCPNLTHMLLDFSTAMQLHDFSEMQAFPTKLRYMCVC 163
            . |....|:|:...::    :......|.|..|:.::......:.|...:..........:....
 Frog   109 K-RHSNHLQYVSFKVD----SSKESAEAACDILSQLVNCSLKTLGLISTARPSFMDLPKSHFISA 168

  Fly   164 LSEVIFMEGFMRKIYNFINGLEVLHLIGTYEKCEEEEEEIYEVINVHKLK----SATPNLR---- 220
            |:.|            |:|...:..|.......::...::....|...||    |:.|::.    
 Frog   169 LTVV------------FVNSKSLSSLKIDDTPVDDPSLKVLVANNSDTLKLLKMSSCPHVSPAGI 221

  Fly   221 -------------VINLYGINFIDDSHIDAFSS-NCIQLECLAVNFCNKVTGSTLKTLIQRSKRL 271
                         .:|.|   .:.|..:.|.|| ..::||.|.::..::..|.|....||:|. .
 Frog   222 LCVADQCHGLRELALNYY---LLSDELLIALSSEKHVRLEHLRIDVVSENPGQTQFHTIQKSS-W 282

  Fly   272 TCLLMNGTSLKSE---FVMQAEWDKCALQELDITATDLSTECLVDMLSRI----PSLKFL--SAG 327
            ..|:.:...:...   |:.:.|:|.....|..:|..........::|.|:    |.|..|  .|.
 Frog   283 DALIKHSPKVNLVMYFFLYEEEFDPFFRYETPVTHLYFGRSVSKEVLGRVGMTCPRLVELVVCAN 347

  Fly   328 QINGFNDSVLKQWMESGTTRSLISLDLDSSDNISDEGLLKFIQRQGHQLSACCLSGMPHITDQLW 392
            .:...::.:::   .:...:||.::.|...: :|....::|::..|.:||...:.....|.||.:
 Frog   348 GLRPLDEELIR---IAERCKSLTAIGLGECE-VSCSAFVEFVKMCGGRLSQLSIMEEVLIPDQKY 408

  Fly   393 MSILPLLGNCKIIVMGTAEKLGVNIHVDQLMDTIASNCGNLERLELRWDPD 443
                                     :::|:...::.:.|.:      |.||
 Frog   409 -------------------------NLEQIHWEVSKHLGRV------WFPD 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 13/45 (29%)
leucine-rich repeat 131..156 CDD:275381 2/24 (8%)
leucine-rich repeat 157..175 CDD:275381 2/17 (12%)
leucine-rich repeat 219..244 CDD:275381 6/42 (14%)
leucine-rich repeat 245..270 CDD:275381 8/24 (33%)
leucine-rich repeat 271..295 CDD:275381 4/26 (15%)
leucine-rich repeat 296..320 CDD:275381 4/27 (15%)
leucine-rich repeat 321..348 CDD:275381 3/28 (11%)
leucine-rich repeat 349..375 CDD:275381 5/25 (20%)
leucine-rich repeat 376..403 CDD:275381 5/26 (19%)
leucine-rich repeat 405..432 CDD:275381 1/26 (4%)
fbxl3NP_001016128.1 F-box-like 41..82 CDD:403981 12/37 (32%)
leucine-rich repeat 179..204 CDD:275381 2/24 (8%)
leucine-rich repeat 205..230 CDD:275381 4/24 (17%)
leucine-rich repeat 231..256 CDD:275381 6/27 (22%)
leucine-rich repeat 257..293 CDD:275381 9/36 (25%)
leucine-rich repeat 294..338 CDD:275381 7/43 (16%)
leucine-rich repeat 339..365 CDD:275381 3/28 (11%)
leucine-rich repeat 366..391 CDD:275381 5/25 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.