DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and FBXL12

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:XP_016882401.1 Gene:FBXL12 / 54850 HGNCID:13611 Length:343 Species:Homo sapiens


Alignment Length:365 Identity:70/365 - (19%)
Similarity:115/365 - (31%) Gaps:135/365 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 NVSLRPEVSGLHVGSLEMLLQLISVRFGPTLRYIELPIELITHTVLHELSAKCPNLTHMLL---D 137
            ::.:||:|. .|:....|..:|.|:|.|..| :.......::..:|..|..|||||..:.|   |
Human    68 HLQMRPKVM-WHLLRRYMASRLHSLRMGGYL-FSGSQAPQLSPALLRALGQKCPNLKRLCLHVAD 130

  Fly   138 FS-----------TAMQLHD------FSEMQAFPTKLRYM-CVCLSEV-IFMEGFMRKIYNFING 183
            .|           ..::||.      :...|..||.|..: |:.|..| .|.:..::.:..| ..
Human   131 LSMVPITSLPSTLRTLELHSCEISMAWLHKQQDPTVLPLLECIVLDRVPAFRDEHLQGLTRF-RA 194

  Fly   184 LEVLHLIGTYEKCEEEEEEIYEVINVHKLKSATPNLRVINLYGINFIDDSHIDAFSSNCIQLECL 248
            |..|.|.|||.                                   :.::.:||.......|:.|
Human   195 LRSLVLGGTYR-----------------------------------VTETGLDAGLQELSYLQRL 224

  Fly   249 AVNFCNKVTGSTLKTLIQ--RSKRLTCLLMNGTSLKSEFVMQAEWDKCALQELDI---------- 301
            .|..|.....|||..:.:  |..|...|.:.|.|.....|::.   ..||:.|.:          
Human   225 EVLGCTLSADSTLLAISRHLRDVRKIRLTVRGLSAPGLAVLEG---MPALESLCLQGPLVTPEMP 286

  Fly   302 TATDLSTECLVDMLSRIPSLKFLSAGQINGFNDSVLKQWMESGTTRSLISLDLDSSDNISDEGLL 366
            :.|::.:.||.     :|.|:.|   ::.|..      |                          
Human   287 SPTEILSSCLT-----MPKLRVL---ELQGLG------W-------------------------- 311

  Fly   367 KFIQRQGHQLSACCLSGMPHITDQLWMSILPLLGNCKIIV 406
                 :|.:.......|:||               |.:||
Human   312 -----EGQEAEKILCKGLPH---------------CMVIV 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 0/3 (0%)
leucine-rich repeat 131..156 CDD:275381 8/44 (18%)
leucine-rich repeat 157..175 CDD:275381 5/19 (26%)
leucine-rich repeat 219..244 CDD:275381 2/24 (8%)
leucine-rich repeat 245..270 CDD:275381 8/26 (31%)
leucine-rich repeat 271..295 CDD:275381 4/23 (17%)
leucine-rich repeat 296..320 CDD:275381 5/33 (15%)
leucine-rich repeat 321..348 CDD:275381 4/26 (15%)
leucine-rich repeat 349..375 CDD:275381 1/25 (4%)
leucine-rich repeat 376..403 CDD:275381 3/26 (12%)
leucine-rich repeat 405..432 CDD:275381 2/2 (100%)
FBXL12XP_016882401.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5688
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.