DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and FBXL19

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001093254.2 Gene:FBXL19 / 54620 HGNCID:25300 Length:694 Species:Homo sapiens


Alignment Length:284 Identity:66/284 - (23%)
Similarity:104/284 - (36%) Gaps:76/284 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RSPFADT------TIEKLPDKVLLHIFSYLSHREICRLARICRRWRQIAYDTRLWKNVSLR---- 80
            |||..||      :...||....|.:|.:|..||:|...|:||.|.:..||.|||..:.|.    
Human   407 RSPEPDTLPLAAGSDHPLPRAAWLRVFQHLGPRELCICMRVCRTWSRWCYDKRLWPRMDLSRRKS 471

  Fly    81 ---PEVSGL-----------HVG-SLEMLLQLISVRFG----------------------PTLRY 108
               |.:||:           ..| |.:.|:.|::...|                      |.||.
Human   472 LTPPMLSGVVRRQPRALDLSWTGVSKKQLMWLLNRLQGLQELVLSGCSWLSVSALGSAPLPALRL 536

  Fly   109 IELP-IELITHTVLHELSAKCPNLTHMLLDFSTAMQLHDFSEMQAFPTKLRYMCVCLSEVIFMEG 172
            ::|. ||.:..:.|.||....|:        :...|......:|.. .:||     |:.:...:.
Human   537 LDLRWIEDVKDSQLRELLLPPPD--------TKPGQTESRGRLQGV-AELR-----LAGLELTDA 587

  Fly   173 FMRKIYNFINGLEVLHLIGTYEKCEEEEEEIYEVINVHKLKSATPNLRV----INLYGINFIDDS 233
            .:|.:......|..|.|    ..|....:.     :||.|.:.|..||.    :||.|.:.:.|.
Human   588 SLRLLLRHAPQLSALDL----SHCAHVGDP-----SVHLLTAPTSPLRETLVHLNLAGCHRLTDH 643

  Fly   234 HIDAFSSNCIQLECLAVNFCNKVT 257
            .:..| ..|.:|..|.:..|.:::
Human   644 CLPLF-RRCPRLRRLDLRSCRQLS 666

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 17/45 (38%)
leucine-rich repeat 131..156 CDD:275381 2/24 (8%)
leucine-rich repeat 157..175 CDD:275381 3/17 (18%)
leucine-rich repeat 219..244 CDD:275381 8/28 (29%)
leucine-rich repeat 245..270 CDD:275381 3/13 (23%)
leucine-rich repeat 271..295 CDD:275381
leucine-rich repeat 296..320 CDD:275381
leucine-rich repeat 321..348 CDD:275381
leucine-rich repeat 349..375 CDD:275381
leucine-rich repeat 376..403 CDD:275381
leucine-rich repeat 405..432 CDD:275381
FBXL19NP_001093254.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
zf-CXXC <50..77 CDD:251032
PHD_FXL19 87..148 CDD:277115
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 150..420 5/12 (42%)
F-box-like 424..465 CDD:315592 17/40 (43%)
leucine-rich repeat 461..485 CDD:275381 5/23 (22%)
AMN1 466..665 CDD:332986 44/222 (20%)
leucine-rich repeat 486..508 CDD:275381 4/21 (19%)
LRR 1 492..517 5/24 (21%)
leucine-rich repeat 510..533 CDD:275381 0/22 (0%)
LRR 2 518..541 4/22 (18%)
leucine-rich repeat 534..573 CDD:275381 10/46 (22%)
leucine-rich repeat 574..598 CDD:275381 4/29 (14%)
LRR 3 581..606 4/28 (14%)
leucine-rich repeat 599..623 CDD:275381 7/32 (22%)
LRR 4 607..636 9/33 (27%)
leucine-rich repeat 629..653 CDD:275381 6/24 (25%)
LRR 5 637..661 5/24 (21%)
leucine-rich repeat 654..686 CDD:275381 3/13 (23%)
LRR 6 662..694 1/5 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153072
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.