DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and Fbxl16

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:XP_038942467.1 Gene:Fbxl16 / 494223 RGDID:1309127 Length:488 Species:Rattus norvegicus


Alignment Length:464 Identity:104/464 - (22%)
Similarity:175/464 - (37%) Gaps:105/464 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LAVEASQVYL-------SDGTVRSPFADTTIEKLP----DKVLLHIFSYLSHREICRLARICRRW 64
            ||...|:|.|       :.|....|.....:|:.|    :|:|..:|.|.|..|.|.||::|:.|
  Rat    60 LATPLSRVALAGGPCPPASGPASGPVPGPPVERPPLATDEKILNGLFWYFSACEKCILAQVCKAW 124

  Fly    65 RQIAYDTRLWKNVSLRPEVSGLHVGSLEMLL-----QLISVRFGPTLRYIE---------LPI-E 114
            |::.|..:.|  ..|.|.   ||...|..:|     :.:::: |...|..|         |.| |
  Rat   125 RRVLYQPKFW--AGLTPV---LHAKELYNVLPGGEKEFVNLQ-GFAARGFEGFCLVGVSDLDICE 183

  Fly   115 LITHTVLHELSAKCPNLTH----------MLLDFSTAMQL-----HDFSEMQAFPT-KLRYMCVC 163
            .|.:..|.:...|..:|..          ||......::|     :||:|...:.: ..|...:.
  Rat   184 FIDNYSLSKKGVKAMSLKRSTITDAGLEVMLEQMQGVVRLELSGCNDFTEAGLWSSLSARITSLS 248

  Fly   164 LSEVI-----FMEGFMRKIYNFIN-GLEVLHLIGT---YEKCEEEEE-------EIYEVIN---- 208
            :|:.|     .:....:.:.|... .|:..|:..|   |....:...       ..:|:.|    
  Rat   249 VSDCINVADDAIAAISQLLPNLAELSLQAYHVTDTALAYFTARQGHSTHTLRLLSCWEITNHGVV 313

  Fly   209 --VHKLKSATPNLRVINLYGINFIDDSHIDAFSSNCIQLECLAVNFCNKVTGSTLKTLIQRSKRL 271
              ||.|    |||..::|.|.:.:.|..::..:.|..:|..|.:::|.::|...|:.:.....||
  Rat   314 NVVHSL----PNLTSLSLSGCSKVTDDGVELVAENLRKLRSLDLSWCPRITDMALEYVACDLHRL 374

  Fly   272 TCLLMNGTSLKSEFVMQAEWDKCALQE-----LDITATDLSTECLVDMLSRIPSLKFLSAGQING 331
            ..|::               |:|....     :.||.|.||   .:..:|.:.||......|:..
  Rat   375 EELVL---------------DRCTHPYTPGWCVRITDTGLS---YLSTMSSLRSLYLRWCCQVQD 421

  Fly   332 FNDSVLKQWMESGTTRSLISLDLDSSDNISDEGLLKFIQRQGHQLSACCLSGMPHITDQLWMSIL 396
            |.   ||..:   ..|||..|.|.....::..||...:|.|  :|....|:..|..|.:|:....
  Rat   422 FG---LKHLL---AMRSLRLLSLAGCPLLTTTGLSGLVQLQ--ELEELELTNCPGATPELFKYFS 478

  Fly   397 PLLGNCKII 405
            ..|..|.:|
  Rat   479 QHLPRCLVI 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 16/49 (33%)
leucine-rich repeat 131..156 CDD:275381 7/40 (18%)
leucine-rich repeat 157..175 CDD:275381 3/22 (14%)
leucine-rich repeat 219..244 CDD:275381 5/24 (21%)
leucine-rich repeat 245..270 CDD:275381 5/24 (21%)
leucine-rich repeat 271..295 CDD:275381 3/23 (13%)
leucine-rich repeat 296..320 CDD:275381 6/28 (21%)
leucine-rich repeat 321..348 CDD:275381 5/26 (19%)
leucine-rich repeat 349..375 CDD:275381 7/25 (28%)
leucine-rich repeat 376..403 CDD:275381 6/26 (23%)
leucine-rich repeat 405..432 CDD:275381 1/1 (100%)
Fbxl16XP_038942467.1 leucine-rich repeat 195..219 CDD:275381 4/23 (17%)
AMN1 201..422 CDD:187754 45/242 (19%)
leucine-rich repeat 220..243 CDD:275381 4/22 (18%)
leucine-rich repeat 244..269 CDD:275381 2/24 (8%)
leucine-rich repeat 270..321 CDD:275381 9/54 (17%)
leucine-rich repeat 322..347 CDD:275381 5/24 (21%)
leucine-rich repeat 348..373 CDD:275381 5/24 (21%)
leucine-rich repeat 374..407 CDD:275381 9/50 (18%)
leucine-rich repeat 408..427 CDD:275381 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.