DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and fbxl3b

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001006075.1 Gene:fbxl3b / 450055 ZFINID:ZDB-GENE-041010-178 Length:162 Species:Danio rerio


Alignment Length:132 Identity:31/132 - (23%)
Similarity:51/132 - (38%) Gaps:33/132 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KLPDKVLLHIFSYLSHREICRLARICRRWRQIAYDTRLWKNVSL---RPEVSGLHVGSLEMLLQL 97
            :||.::||.|..||...:....:::|.||.|..:...||:....   :|..|.|.....|::.|:
Zfish    41 QLPQEILLQILQYLPLLDRAIASQVCHRWNQAFHMPELWRCFEFELNQPASSYLQATHPELIKQI 105

  Fly    98 ISVRFGPTLRYIELPIELITHTVLHELSAKCPNLTHMLLDFSTAMQLHDFSEMQAFPTKLRYMCV 162
            |. |....|:|:...:...|||.|.:     |..|.:.                        :||
Zfish   106 IK-RHANHLQYVSFKVRTHTHTQLTQ-----PTFTPVC------------------------VCV 140

  Fly   163 CL 164
            |:
Zfish   141 CV 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 13/46 (28%)
leucine-rich repeat 131..156 CDD:275381 1/24 (4%)
leucine-rich repeat 157..175 CDD:275381 3/8 (38%)
leucine-rich repeat 219..244 CDD:275381
leucine-rich repeat 245..270 CDD:275381
leucine-rich repeat 271..295 CDD:275381
leucine-rich repeat 296..320 CDD:275381
leucine-rich repeat 321..348 CDD:275381
leucine-rich repeat 349..375 CDD:275381
leucine-rich repeat 376..403 CDD:275381
leucine-rich repeat 405..432 CDD:275381
fbxl3bNP_001006075.1 F-box-like 39..80 CDD:289689 12/38 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.