Sequence 1: | NP_733291.1 | Gene: | FipoQ / 43475 | FlyBaseID: | FBgn0039667 | Length: | 515 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_795933.2 | Gene: | Fbxl7 / 448987 | MGIID: | 3052506 | Length: | 491 | Species: | Mus musculus |
Alignment Length: | 386 | Identity: | 83/386 - (21%) |
---|---|---|---|
Similarity: | 146/386 - (37%) | Gaps: | 134/386 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 TIEKLPDKVLLHIFSYLSHREICRLARICRRWRQIAYDTRLWKNVSL------------------ 79
Fly 80 --------------------------------------RPEVSGLHVGSLEMLLQLI-------- 98
Fly 99 ------------------SVRFGP------TLRYIEL-PIELITHTVLHELSAKCPNLTHMLLDF 138
Fly 139 STAMQLHDFSEMQAFPTKLRYMCV-C-------LSEVIFMEGF----MRKIYNFINGLEVLHLIG 191
Fly 192 TYEKCEEEEEEIYEVINVHKLKSATPNLRVINLYGINFIDDSHIDAFSSNCIQLECLAVNFCNKV 256
Fly 257 TGSTLKTLIQRSKRLTCLLMNGTSLKS-EFV----MQAEWDKC-ALQELDITATDLSTECL 311 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
FipoQ | NP_733291.1 | F-box-like | 34..80 | CDD:289689 | 22/101 (22%) |
leucine-rich repeat | 131..156 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 157..175 | CDD:275381 | 7/29 (24%) | ||
leucine-rich repeat | 219..244 | CDD:275381 | 8/24 (33%) | ||
leucine-rich repeat | 245..270 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 271..295 | CDD:275381 | 9/29 (31%) | ||
leucine-rich repeat | 296..320 | CDD:275381 | 6/16 (38%) | ||
leucine-rich repeat | 321..348 | CDD:275381 | |||
leucine-rich repeat | 349..375 | CDD:275381 | |||
leucine-rich repeat | 376..403 | CDD:275381 | |||
leucine-rich repeat | 405..432 | CDD:275381 | |||
Fbxl7 | NP_795933.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..79 | ||
F-box-like | 114..160 | CDD:289689 | 21/45 (47%) | ||
leucine-rich repeat | 129..151 | CDD:275381 | 10/21 (48%) | ||
leucine-rich repeat | 154..187 | CDD:275381 | 2/32 (6%) | ||
AMN1 | <185..366 | CDD:187754 | 32/202 (16%) | ||
LRR 1 | 185..210 | 0/24 (0%) | |||
leucine-rich repeat | 188..213 | CDD:275381 | 0/24 (0%) | ||
LRR 2 | 211..236 | 7/24 (29%) | |||
leucine-rich repeat | 214..234 | CDD:275381 | 7/19 (37%) | ||
LRR 3 | 237..262 | 0/24 (0%) | |||
leucine-rich repeat | 240..273 | CDD:275381 | 2/32 (6%) | ||
LRR 4 | 271..296 | 4/24 (17%) | |||
leucine-rich repeat | 274..299 | CDD:275381 | 6/24 (25%) | ||
AMN1 | 297..464 | CDD:187754 | 44/193 (23%) | ||
LRR 5 | 297..322 | 10/34 (29%) | |||
leucine-rich repeat | 300..325 | CDD:275381 | 10/34 (29%) | ||
LRR 6 | 323..348 | 4/24 (17%) | |||
leucine-rich repeat | 326..351 | CDD:275381 | 4/24 (17%) | ||
LRR 7 | 349..374 | 3/36 (8%) | |||
leucine-rich repeat | 352..377 | CDD:275381 | 3/36 (8%) | ||
LRR 8 | 375..400 | 6/24 (25%) | |||
leucine-rich repeat | 378..403 | CDD:275381 | 8/24 (33%) | ||
LRR 9 | 401..426 | 7/29 (24%) | |||
leucine-rich repeat | 404..429 | CDD:275381 | 8/29 (28%) | ||
LRR 10 | 427..452 | 7/24 (29%) | |||
leucine-rich repeat | 430..453 | CDD:275381 | 6/22 (27%) | ||
leucine-rich repeat | 456..480 | CDD:275381 | 6/16 (38%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167843166 | |
Domainoid | 1 | 1.000 | 59 | 1.000 | Domainoid score | I10630 |
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1027299at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.750 |