DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and CG5003

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster


Alignment Length:345 Identity:74/345 - (21%)
Similarity:123/345 - (35%) Gaps:92/345 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DKVLLHIFSYLSHREICRLARICRRWRQIAYDTRLWKNVSLRPEVSG-LHVGSLEMLL------- 95
            |::|..||.||....|..:.....|:..:..|.|.:.::.|.   :| |.:|.||.:|       
  Fly    74 DELLFEIFQYLDTSSILAVMHCSPRFENLLLDHRFYHHIDLS---NGPLPMGILEEILGRATEKT 135

  Fly    96 QLISVRFGPTLRYIELPIELITHTVLHELSAKCPNLTHM--------LLDFSTAMQLHDFSEMQA 152
            ..|.:...|:.:::.......|.|    ||:..|.:..:        .|||       ::..:..
  Fly   136 HTIKICGPPSSQHVAGEFRQFTQT----LSSVFPRVVQLKVLELEGVSLDF-------EYIHITE 189

  Fly   153 FPTKLRYMCVCLSEVIFMEGFMRKIYNFINGLEVLHLIGTYEKCEEEEE--EIYEVINVHKLKSA 215
            ||..||.:  .|.:.....|...|  :....:| |||:...:...|:..  |.|.::.:.||   
  Fly   190 FPATLRRL--KLKDCSVRVGDTPK--SIFYSIE-LHLLDLEDLSIEDNSWFEPYYIMGLSKL--- 246

  Fly   216 TPNLRVINLYGINFIDDSHIDAFSSNCIQLECLAVNFCNKVTGSTLKTLIQRSKRLTCLLMNGTS 280
             |:||.::|.|                    |.|:                      |..:...|
  Fly   247 -PSLRRLSLKG--------------------CQAL----------------------CKFVPYGS 268

  Fly   281 LKSEFVMQAEWDKCALQELDITATDLSTECLVDMLSRIPSLK--FLSAGQINGFNDSVLKQWMES 343
            :.:.|..|      .|:.||:..|.::...| ...|.|.:||  .|.:.||.....:|.|:....
  Fly   269 MAARFGFQ------KLESLDLRQTPINNSDL-QCFSAIENLKELLLESPQILHSKQAVAKKNTNG 326

  Fly   344 GTTRSLISLDLDSSDNISDE 363
            ..|....|...||...:||:
  Fly   327 NATDEAASPQPDSLKVLSDD 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 10/40 (25%)
leucine-rich repeat 131..156 CDD:275381 5/32 (16%)
leucine-rich repeat 157..175 CDD:275381 4/17 (24%)
leucine-rich repeat 219..244 CDD:275381 4/24 (17%)
leucine-rich repeat 245..270 CDD:275381 2/24 (8%)
leucine-rich repeat 271..295 CDD:275381 4/23 (17%)
leucine-rich repeat 296..320 CDD:275381 7/23 (30%)
leucine-rich repeat 321..348 CDD:275381 8/28 (29%)
leucine-rich repeat 349..375 CDD:275381 5/15 (33%)
leucine-rich repeat 376..403 CDD:275381
leucine-rich repeat 405..432 CDD:275381
CG5003NP_651593.1 F-box 68..114 CDD:279040 10/39 (26%)
leucine-rich repeat 610..635 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457985
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5688
32.840

Return to query results.
Submit another query.