DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and CG14891

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_650560.1 Gene:CG14891 / 42013 FlyBaseID:FBgn0038445 Length:495 Species:Drosophila melanogaster


Alignment Length:490 Identity:107/490 - (21%)
Similarity:165/490 - (33%) Gaps:177/490 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VEASQVYLSDGTVRSPFADTTIEK--------LP--DKVLLHIFSYLSHREICRLARICRRWRQI 67
            ::...:||...|...|   |.:|:        ||  |.:...:..|||..|....|..|.|::.|
  Fly    85 IDGHDLYLQASTSWHP---TPVEESGTLSAYDLPITDDIWWKVLDYLSLNERLNFAASCERFQAI 146

  Fly    68 AYDTRLWKNVSLRPEVSGLHVGSLEMLLQLISVRFGPTLRYIELPIELITHTVLHELSAK--CPN 130
                                                         .||.:|.:.|.|:.|  | .
  Fly   147 ---------------------------------------------YELDSHRINHVLNMKDVC-T 165

  Fly   131 LTH------MLLDFS-----TAMQLH-DFSEMQAFPTKLRYMCVCLSEVIFME-----GFMRKIY 178
            |||      |||...     |...|| ::..:..|...|...|..|:|:.|.:     ..|..::
  Fly   166 LTHRVIKRLMLLSGKHIHCVTGGPLHPNWPYLTEFVQLLGVSCPNLTELSFFKISVSLAHMTHLF 230

  Fly   179 NFINGLEVLHLIGTYEKCEEEEEEIYEVINVHKLKSATPNLRVINLYGINFIDDSHIDAFSSNCI 243
            :..|||..:..| :..:|..::..||.:..:.||||    |.:...:.|..      |:..|..|
  Fly   231 DGANGLINITNI-SLRRCNLKDAHIYCLQMLSKLKS----LDIRENFSIKG------DSLKSLPI 284

  Fly   244 QLECLAVNFCNKVTGSTLKTLIQRSKRLTCLLMNGTSLKSEFVMQAEWDK---------CALQEL 299
            .||.|.|:.|..::.   |.|||     ...|.:...|:...:::...|.         |.:.|:
  Fly   285 SLEILNVSGCVDLSP---KCLIQ-----LAALSHLRELRCPGIVKFAKDNELYGRLAHYCPMLEV 341

  Fly   300 DITATDLSTECLVDMLSRIPSLKFLSAGQIN--------------------------------GF 332
             :..||......:..|||:.:|...|:.|::                                .|
  Fly   342 -LELTDFMNVIQLGGLSRLHTLVIHSSAQLDYHVNNVLLTSIAESYSLRHLEILDSFGPMSDTSF 405

  Fly   333 NDSVLKQWME---------SGTTRSLIS---------LDLDSSDNISDEGLLKFIQRQGHQLSAC 379
            :.|:..|..|         :.||..|:.         |||..|.|:|:|.:.|..:         
  Fly   406 DLSIFSQLKELRTLILHNQNFTTLHLMGLQKLSTLEFLDLSGSPNLSNEVVAKLTK--------- 461

  Fly   380 CLSGM--------PHITDQLWMSILPLLGNCKIIV 406
            .|||:        |.||.|| ..||.  ||.|:.|
  Fly   462 SLSGLRRLKVDFCPLITRQL-TKILE--GNPKLQV 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 12/55 (22%)
leucine-rich repeat 131..156 CDD:275381 10/36 (28%)
leucine-rich repeat 157..175 CDD:275381 5/22 (23%)
leucine-rich repeat 219..244 CDD:275381 4/24 (17%)
leucine-rich repeat 245..270 CDD:275381 9/24 (38%)
leucine-rich repeat 271..295 CDD:275381 3/32 (9%)
leucine-rich repeat 296..320 CDD:275381 6/23 (26%)
leucine-rich repeat 321..348 CDD:275381 9/67 (13%)
leucine-rich repeat 349..375 CDD:275381 9/34 (26%)
leucine-rich repeat 376..403 CDD:275381 12/34 (35%)
leucine-rich repeat 405..432 CDD:275381 1/2 (50%)
CG14891NP_650560.1 RRM_6 25..91 CDD:290958 0/5 (0%)
AMN1 <199..352 CDD:187754 39/172 (23%)
leucine-rich repeat 211..237 CDD:275381 6/25 (24%)
leucine-rich repeat 239..262 CDD:275381 4/23 (17%)
leucine-rich repeat 263..285 CDD:275381 7/31 (23%)
leucine-rich repeat 286..338 CDD:275381 13/59 (22%)
leucine-rich repeat 339..387 CDD:275381 9/48 (19%)
leucine-rich repeat 388..415 CDD:275381 3/26 (12%)
leucine-rich repeat 416..439 CDD:275381 3/22 (14%)
leucine-rich repeat 440..465 CDD:275381 9/33 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457987
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.