DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and CG32085

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_729732.1 Gene:CG32085 / 39311 FlyBaseID:FBgn0052085 Length:666 Species:Drosophila melanogaster


Alignment Length:524 Identity:111/524 - (21%)
Similarity:181/524 - (34%) Gaps:191/524 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 WGQLAVEASQVYLSDGTVRSPFADTTIEK--LPDKVLLHIFSYLSHREICRLARICRRWRQIAY- 69
            :|.:.:.|:...:....:..| ...:||:  |.|:.|...|.|.|..|...||::|.:||...| 
  Fly   255 YGSMGINAASPLIMQHQLHPP-PIHSIEQLMLDDRFLSRFFQYFSPYERRILAQVCIKWRDTLYR 318

  Fly    70 DTRLWKNVSLRPEVSGLHVGSLEMLLQLISVRFGPTLRYIELPIELITHTVLHELSAKCPNLTHM 134
            ..|.|         |||.                |||:..|                        
  Fly   319 SPRYW---------SGLL----------------PTLQCRE------------------------ 334

  Fly   135 LLDFSTAMQLHDFSEMQAFPTKLRYMCVCLSEVIFMEGFMRKIYNFI--NGLEVLHLIGTYEKCE 197
                                  ||.|..|         ...|:||.:  .|...|.|:|.     
  Fly   335 ----------------------LRQMPGC---------DRGKLYNSLIRRGFHALGLVGA----- 363

  Fly   198 EEEEEIYEVINVHKLKSATPNLRVINLYGINFIDDSHIDAFSSNCIQLECLAVNFCNKVTGSTLK 262
             .:|:..:|::...|.|                  .|:.:.|..           |:.::...|:
  Fly   364 -SDEDALDVVHSFPLAS------------------KHVHSLSLR-----------CSSISDRGLE 398

  Fly   263 TLIQRSKRLTCLLMNGTSLKSEFVMQAEWDKCALQELDITATDLSTE-----CLVDMLSRIPSLK 322
            ||:..             |:|.|            ||::...:..||     ||.   .||.||.
  Fly   399 TLLDH-------------LQSLF------------ELELAGCNEVTEAGLWACLT---PRIVSLS 435

  Fly   323 FLSAGQINGFNDSV--LKQWMESGTTRSLISLDLDSSDNISDEGLLKFIQRQGHQLSACCLSGMP 385
            .  |..||..:::|  :.|.:.     ||....|.:. :::|..|..|..:|.|.||...|....
  Fly   436 L--ADCINIADEAVGAVAQLLP-----SLYEFSLQAY-HVTDAALGYFSPKQSHSLSILRLQSCW 492

  Fly   386 HITDQLWMSILPLLGNCKIIVMGTAEKLGVNIHVDQLMDTIASNCGNLERLELRWDPDNLRFSDK 450
            .:|:...::|:..|.:..::.:....||     .|..::.||.|...|..|:|.|.|   |.:|.
  Fly   493 ELTNHGIVNIVHSLPHLTVLSLSGCSKL-----TDDGVELIAENLQKLRALDLSWCP---RITDA 549

  Fly   451 SQK--AIDILRVKCLKL-RCMVLSD---GRYYETVKANFERADRITVVRTTTCCRVSPY---HL- 505
            |.:  |.|:.:::.|.| ||:.::|   | |..|:.:       :|.:....|.:|..:   || 
  Fly   550 SLEYIACDLNQLEELTLDRCVHITDIGVG-YISTMLS-------LTALFLRWCSQVRDFGLQHLC 606

  Fly   506 -LRN 508
             :||
  Fly   607 SMRN 610

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 17/48 (35%)
leucine-rich repeat 131..156 CDD:275381 0/24 (0%)
leucine-rich repeat 157..175 CDD:275381 4/17 (24%)
leucine-rich repeat 219..244 CDD:275381 2/24 (8%)
leucine-rich repeat 245..270 CDD:275381 4/24 (17%)
leucine-rich repeat 271..295 CDD:275381 3/23 (13%)
leucine-rich repeat 296..320 CDD:275381 8/28 (29%)
leucine-rich repeat 321..348 CDD:275381 6/28 (21%)
leucine-rich repeat 349..375 CDD:275381 6/25 (24%)
leucine-rich repeat 376..403 CDD:275381 6/26 (23%)
leucine-rich repeat 405..432 CDD:275381 6/26 (23%)
CG32085NP_729732.1 leucine-rich repeat 382..406 CDD:275381 6/47 (13%)
AMN1 383..600 CDD:187754 64/279 (23%)
leucine-rich repeat 431..456 CDD:275381 8/31 (26%)
leucine-rich repeat 457..482 CDD:275381 6/25 (24%)
leucine-rich repeat 483..508 CDD:275381 6/24 (25%)
leucine-rich repeat 509..534 CDD:275381 6/29 (21%)
leucine-rich repeat 535..560 CDD:275381 10/27 (37%)
leucine-rich repeat 561..585 CDD:275381 8/24 (33%)
leucine-rich repeat 586..610 CDD:275381 5/23 (22%)
leucine-rich repeat 636..661 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457964
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.