DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and CG4911

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001286990.1 Gene:CG4911 / 39043 FlyBaseID:FBgn0035959 Length:450 Species:Drosophila melanogaster


Alignment Length:483 Identity:87/483 - (18%)
Similarity:159/483 - (32%) Gaps:187/483 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KLPDKVLLHIFSYLSHREICRLARICRRWRQIAYDTRLWKN------VSLRPEVSGLHVGSLEML 94
            ::|...|.|||.||:.::....|.:|..||...:..|.::|      |....:::..|.....:.
  Fly    12 RIPSVALNHIFDYLNPQDRRSAAGVCFSWRHALFQKRYFRNFRFQLDVGCDDQLAFFHRSMANLA 76

  Fly    95 LQLISVRFGPTLRYIELPIELITHTVLHELSAKCPNL------TH-------------------- 133
            ::||.|.......:|: .:..:.:.|.|     |.|:      ||                    
  Fly    77 MELIVVFDFQNAVHIQ-KMRGLLYKVAH-----CDNIQKLRFQTHNVGLVAIGNMHSEHLLAIEQ 135

  Fly   134 -----------------MLLDFSTAMQL----HDFSEMQAFPTKL-------------RYMCVCL 164
                             .|||......|    |||.:....|.:|             .|..:.|
  Fly   136 CFVEPLILFLSRKRQPCQLLDLGAIEALSYYGHDFLKAMGKPQELLQLTLASIKYDPSHYPILSL 200

  Fly   165 SEVIFMEGFMRKIYNFINGLEVLHLIGTYEKCEEEEEEIYEVINVHKLKSATPNLRVINLYGINF 229
            ...:..:         ...|:||.|  .|:...:|.....:|:.:.||        :|.::|:: 
  Fly   201 DSTLLQK---------CAALQVLSL--DYDTLSDELLHTIQVLPLRKL--------LIAVHGLD- 245

  Fly   230 IDDSHIDA-----------FSSNCIQL--------ECLA-----------------VNFCNKVTG 258
             .:.|.|.           |||  |:|        |.:|                 :.||.|:..
  Fly   246 -SEEHPDVSETAWSNFSDHFSS--IELVLTLVYAYEAIALLQHRVLRSNMPVTHVRLLFCEKMNA 307

  Fly   259 -----------STLKTL------------IQRSKRLTCLLMNGTSLKSEFVMQAEWDKCALQELD 300
                       .||:::            :..|:|::.       |:..|||.| |....|:|:.
  Fly   308 EALDWMSLHYRETLRSIHYVDAPYKYSNRMNSSRRVSL-------LQDPFVMMA-WRCKQLEEIV 364

  Fly   301 ITATDLSTECLVDM-------LSR--IPSLKFLSAGQINGFNDSVL----KQWMESGTTRSLISL 352
            :....:....||.:       |.|  :..:.:..|..:|.:|:.:.    :||       |.||.
  Fly   365 VHGYLMDPHNLVGIARLRGRQLKRLEVSMIDWSGAPLLNAYNEEISTLLGQQW-------SPISF 422

  Fly   353 D-----LDSSDNISDEGLLKFIQRQGHQ 375
            |     |...:::.|:.:.:.:::...|
  Fly   423 DKMPPSLFYDNDLRDQFVYEMLRQDLRQ 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 14/49 (29%)
leucine-rich repeat 131..156 CDD:275381 10/71 (14%)
leucine-rich repeat 157..175 CDD:275381 3/30 (10%)
leucine-rich repeat 219..244 CDD:275381 7/35 (20%)
leucine-rich repeat 245..270 CDD:275381 9/72 (13%)
leucine-rich repeat 271..295 CDD:275381 6/23 (26%)
leucine-rich repeat 296..320 CDD:275381 6/32 (19%)
leucine-rich repeat 321..348 CDD:275381 5/30 (17%)
leucine-rich repeat 349..375 CDD:275381 5/30 (17%)
leucine-rich repeat 376..403 CDD:275381 87/483 (18%)
leucine-rich repeat 405..432 CDD:275381
CG4911NP_001286990.1 F-box 8..53 CDD:279040 12/40 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20933
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.