DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and fbxl2

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_956400.1 Gene:fbxl2 / 378737 ZFINID:ZDB-GENE-030925-12 Length:432 Species:Danio rerio


Alignment Length:487 Identity:107/487 - (21%)
Similarity:189/487 - (38%) Gaps:148/487 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 EKLPDKVLLHIFSYLSHREICRLARICRRWRQIAYDTRLWKNVSL---RPEVSGLHVGSLEMLLQ 96
            :|||.::||.|||||....:||.|::.:.|..:|.|...|:.:.|   :.::.|       .:::
Zfish    22 KKLPKELLLRIFSYLDVVTLCRCAQVSKAWNVLALDGSNWQKIDLFNFQTDIEG-------RVVE 79

  Fly    97 LISVRFGPTLRYIELPIEL-ITHTVLHELSAKCPNLTHMLLDFSTAMQLHDFSEMQAFPTKLRYM 160
            .||.|.|..||.:.|...| :....:...:..|.|:.|:.|:..|  ::.|.:            
Zfish    80 NISKRCGGFLRQLSLRGCLSVGDASMKTFAQNCRNIEHLNLNGCT--KITDST------------ 130

  Fly   161 CVCLSEVIFMEGFMRKIYNFINGLEVLHLIGTYEKCEEEEEEIYEVINVHKLKSATPNLRVINLY 225
            |:.||:..|                                                .||.::|.
Zfish   131 CISLSKFCF------------------------------------------------KLRHLDLT 147

  Fly   226 GINFIDDSHIDAFSSNCIQLECLAVNFCNKVTGSTLKTLIQRSKRLTCLLMNGTSLKSEFVMQAE 290
            ....|.:..:.|.|..|..||.|.:::|:::|...::.|.:....|..|.:.|.:          
Zfish   148 SCVSITNHALKALSEGCRMLENLNLSWCDQITSDGIEALSRGCTALRALFLRGCT---------- 202

  Fly   291 WDKCALQELDITATDLSTECLVDMLSRIPSLKFLSAGQINGFNDSVLKQWMESGTTRSLISLDLD 355
                   :||.||                 ||.|.            |...|      |:::::.
Zfish   203 -------QLDDTA-----------------LKHLQ------------KHCPE------LMTINMQ 225

  Fly   356 SSDNISDEGLLKFIQRQGHQLSACCLSGMPHITDQLWMSILPLLG-NCKIIVMGTAEKLGVNIHV 419
            |...|:|:|.:. :.|..|:|...|:||..:|||    :.|..|| ||:.:.:..|.:..   ||
Zfish   226 SCTQITDDGFVS-LCRGCHKLQMVCISGCSNITD----ASLTALGLNCQRLKILEAARCS---HV 282

  Fly   420 -DQLMDTIASNCGNLERLELRWDPDNLRFSDKS--QKAIDILRVKCLKL-RCMVLSDG--RYYET 478
             |.....:|.||..:|:::|.   :.:..:|.:  |.:|...|::.|.| .|.:::|.  |:..:
Zfish   283 TDAGFTVLARNCHEMEKMDLE---ECILVTDNTLVQLSIHCPRLQALSLSHCELITDDGIRHLSS 344

  Fly   479 VKANFERADRITVVRTTTCCRVSPYHL--LRN 508
            .....|   |:.||....|..::...|  |:|
Zfish   345 SVCGQE---RLQVVELDNCPLITDITLEHLKN 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 18/47 (38%)
leucine-rich repeat 131..156 CDD:275381 4/24 (17%)
leucine-rich repeat 157..175 CDD:275381 4/17 (24%)
leucine-rich repeat 219..244 CDD:275381 7/24 (29%)
leucine-rich repeat 245..270 CDD:275381 6/24 (25%)
leucine-rich repeat 271..295 CDD:275381 3/23 (13%)
leucine-rich repeat 296..320 CDD:275381 4/23 (17%)
leucine-rich repeat 321..348 CDD:275381 5/26 (19%)
leucine-rich repeat 349..375 CDD:275381 6/25 (24%)
leucine-rich repeat 376..403 CDD:275381 11/27 (41%)
leucine-rich repeat 405..432 CDD:275381 7/27 (26%)
fbxl2NP_956400.1 F-box-like 24..66 CDD:289689 16/41 (39%)
leucine-rich repeat 61..88 CDD:275381 7/33 (21%)
AMN1 63..284 CDD:187754 67/349 (19%)
leucine-rich repeat 89..108 CDD:275381 4/18 (22%)
leucine-rich repeat 115..140 CDD:275381 8/86 (9%)
leucine-rich repeat 141..166 CDD:275381 7/24 (29%)
leucine-rich repeat 167..192 CDD:275381 6/24 (25%)
leucine-rich repeat 193..218 CDD:275381 11/70 (16%)
AMN1 212..390 CDD:187754 48/194 (25%)
leucine-rich repeat 219..244 CDD:275381 6/25 (24%)
leucine-rich repeat 245..270 CDD:275381 12/28 (43%)
leucine-rich repeat 271..296 CDD:275381 7/27 (26%)
leucine-rich repeat 297..322 CDD:275381 5/27 (19%)
leucine-rich repeat 323..351 CDD:275381 6/30 (20%)
leucine-rich repeat 352..376 CDD:275381 6/22 (27%)
leucine-rich repeat 377..402 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588065
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.