DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and Ppa

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster


Alignment Length:471 Identity:109/471 - (23%)
Similarity:178/471 - (37%) Gaps:117/471 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PFADTTIEKLPDKVLLHIFSYLSHREICRLARICRRWRQIAYDTRLWKNVSLR-------PEVSG 85
            |...|.|..|..::|..||.:|..|::.|.|::|..||..||...:||.|..:       |.:..
  Fly   143 PVEGTHISNLFPELLEQIFEHLPVRDLGRAAQVCTAWRDAAYAKSVWKGVEAKLHLKRSSPSLFN 207

  Fly    86 LHVGSLEMLLQLISVRFGPTLRYIELPIELITHTVL------------HELSAKCPNLTHMLLDF 138
            ..|......:|::|:|  .:|:.:.|.:..:|...|            |..|...|||  ..||.
  Fly   208 CLVKRGIKKVQILSLR--RSLKDLVLGVPALTSLNLSGCFNVADMNLGHAFSVDLPNL--KTLDL 268

  Fly   139 STAMQLHDFSEMQAFPTKLRYMCVCLSEVIFMEGFMRKIYNFINGLEVLHLIGTYEKCEEEEEEI 203
            |...|:.|.|                         :.:|...:..||.|.|.|.   |       
  Fly   269 SLCKQITDTS-------------------------LGRIAQHLRNLETLELGGC---C------- 298

  Fly   204 YEVINVHKLKSA--TPNLRVINLYGINFIDD---SHIDAFSSNC----IQLECLAVNFCNKVTGS 259
             .:.|...|..|  ...|:.:||.....|.|   .|:..||...    :|||.|.:..|.:::..
  Fly   299 -NITNTGLLLIAWGLKKLKHLNLRSCWHISDQGIGHLAGFSRETAEGNLQLEYLGLQDCQRLSDE 362

  Fly   260 TLKTLIQRSKRLTCLLMNGTSLKSEFVMQAEWDKCALQELDITATDLSTECLVDMLSRIPSLKFL 324
            .|..:.|          ..|||||               ::::.....|:..:..|:|:|.|:.|
  Fly   363 ALGHIAQ----------GLTSLKS---------------INLSFCVSVTDSGLKHLARMPKLEQL 402

  Fly   325 SAGQINGFNDSVLKQWMESGTTRSLISLDLDSSDNISDEGLLKFIQ----RQGHQLSACCLSGMP 385
            :....:..:|..:....|.|:  .:.|||:...|.|||:.|....|    .:...|:.|      
  Fly   403 NLRSCDNISDIGMAYLTEGGS--GINSLDVSFCDKISDQALTHIAQGLYRLRSLSLNQC------ 459

  Fly   386 HITDQLWMSILPLLGNCKIIVMGTAEKLGVNIHVDQLMDTIASNCGNLERLELRWDPDNLRFSDK 450
            .|||...:.|...|...:.:.:|...::     .|:.:.|:|.:..||:.::|      ...:..
  Fly   460 QITDHGMLKIAKALHELENLNIGQCSRI-----TDKGLQTLAEDLTNLKTIDL------YGCTQL 513

  Fly   451 SQKAIDILRVKCLKLR 466
            |.|.|||: :|..||:
  Fly   514 SSKGIDII-MKLPKLQ 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 17/45 (38%)
leucine-rich repeat 131..156 CDD:275381 7/24 (29%)
leucine-rich repeat 157..175 CDD:275381 0/17 (0%)
leucine-rich repeat 219..244 CDD:275381 8/31 (26%)
leucine-rich repeat 245..270 CDD:275381 6/24 (25%)
leucine-rich repeat 271..295 CDD:275381 5/23 (22%)
leucine-rich repeat 296..320 CDD:275381 3/23 (13%)
leucine-rich repeat 321..348 CDD:275381 5/26 (19%)
leucine-rich repeat 349..375 CDD:275381 9/29 (31%)
leucine-rich repeat 376..403 CDD:275381 7/26 (27%)
leucine-rich repeat 405..432 CDD:275381 4/26 (15%)
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 14/40 (35%)
AMN1 <226..>334 CDD:187754 30/145 (21%)
leucine-rich repeat 236..256 CDD:275381 3/19 (16%)
leucine-rich repeat 263..288 CDD:275381 8/51 (16%)
leucine-rich repeat 289..314 CDD:275381 9/35 (26%)
leucine-rich repeat 315..347 CDD:275381 8/31 (26%)
AMN1 347..524 CDD:187754 49/221 (22%)
leucine-rich repeat 348..373 CDD:275381 6/34 (18%)
leucine-rich repeat 374..398 CDD:275381 6/38 (16%)
leucine-rich repeat 399..424 CDD:275381 5/26 (19%)
leucine-rich repeat 425..450 CDD:275381 9/24 (38%)
leucine-rich repeat 451..475 CDD:275381 7/29 (24%)
leucine-rich repeat 476..501 CDD:275381 4/29 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457935
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.