DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and Fbxl6

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001005563.1 Gene:Fbxl6 / 362941 RGDID:1359687 Length:535 Species:Rattus norvegicus


Alignment Length:436 Identity:107/436 - (24%)
Similarity:161/436 - (36%) Gaps:126/436 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 EKLPDKVLLHIFSYL--SHRE---ICRLARICRRWRQIAYDTRLWKNVSLRPEVSGLHV-GSLE- 92
            :::|.:||:|||..|  :|..   :.|.||:||.|.:......||..|:|.|.:.|... |:|: 
  Rat   105 DRIPLEVLVHIFGLLVAAHGPMPFLGRAARVCRHWHEATSHPSLWHTVTLSPALVGRAAKGNLKG 169

  Fly    93 ------MLLQLISVRFGPTLRYIELPIELITHTVLHELSAKCPNLTHMLLD-------------F 138
                  .|..||..||....|...:..:...|:||..:|..||.||.:.|.             .
  Rat   170 EKKLLACLEWLIPNRFSQLQRLTLIHWKSQVHSVLELVSKFCPRLTFLKLSDCHGVTAETLVMLA 234

  Fly   139 STAMQLHDFSEMQAFPTKLRYMCVCLSEVI-FME---GFMRKIY----------------NFING 183
            ....|||...        |.:..|..:.|: |:|   ..||:::                |..:.
  Rat   235 KACCQLHSLD--------LHHSMVESTAVVSFLEEAGSRMRRLWLTYSSQTTAILGALLGNCCSQ 291

  Fly   184 LEVLHLIGTYEKCEEEEEEIYEVINVHKLKSATPNLRVINLYGINFIDD------SHIDAFSSNC 242
            |:||. :.....|.....:    :.|..|:...|.|:|:.|..:.::..      .....|.|  
  Rat   292 LQVLE-VSAGMSCNNTPLQ----LPVEALQRGCPQLQVLRLLNLIWLPKPCGRGAPQGPGFPS-- 349

  Fly   243 IQLECLAVNFCNKVTGSTLKTLIQRSKRLTCLLMNG------TSLKSEFVMQAEWDKCAL--QEL 299
            ::..|||.:.|:.|:...|..|:..|.:|..|.:.|      |.|            |.|  |||
  Rat   350 LEELCLAGSTCSFVSNEVLGRLLHCSPKLRLLDLRGCARITPTGL------------CHLPCQEL 402

  Fly   300 D-------------ITATDLSTECLVDMLSRIPSLKFLSAGQINGFNDSVLKQWME--SGTTR-- 347
            :             ..|.|.|..........:..|.|  :||  ||::..|:|.:.  ||||.  
  Rat   403 EQLYLGLYGMSDGLALAKDGSPLLTQKWYHTLRELDF--SGQ--GFSEKDLEQALAVFSGTTEGL 463

  Fly   348 --SLISLDLD---------SSDNISDEGLLKFIQRQGHQLSAC-CL 381
              :|.||:|.         ||...|..|||..      .|.:| ||
  Rat   464 PPALCSLNLRGTRVTPSTVSSVISSCPGLLYL------NLESCRCL 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 17/49 (35%)
leucine-rich repeat 131..156 CDD:275381 6/37 (16%)
leucine-rich repeat 157..175 CDD:275381 5/21 (24%)
leucine-rich repeat 219..244 CDD:275381 5/30 (17%)
leucine-rich repeat 245..270 CDD:275381 8/24 (33%)
leucine-rich repeat 271..295 CDD:275381 5/29 (17%)
leucine-rich repeat 296..320 CDD:275381 7/38 (18%)
leucine-rich repeat 321..348 CDD:275381 12/32 (38%)
leucine-rich repeat 349..375 CDD:275381 10/34 (29%)
leucine-rich repeat 376..403 CDD:275381 4/7 (57%)
leucine-rich repeat 405..432 CDD:275381
Fbxl6NP_001005563.1 F-box-like 105..155 CDD:289689 17/49 (35%)
AMN1 171..390 CDD:187754 49/233 (21%)
leucine-rich repeat 188..213 CDD:275381 6/24 (25%)
leucine-rich repeat 214..239 CDD:275381 3/24 (13%)
leucine-rich repeat 240..291 CDD:275381 10/58 (17%)
leucine-rich repeat 292..321 CDD:275381 6/33 (18%)
leucine-rich repeat 322..349 CDD:275381 4/26 (15%)
AMN1 <349..500 CDD:187754 45/174 (26%)
leucine-rich repeat 350..377 CDD:275381 8/26 (31%)
leucine-rich repeat 378..401 CDD:275381 7/34 (21%)
leucine-rich repeat 434..466 CDD:275381 12/35 (34%)
leucine-rich repeat 467..491 CDD:275381 7/23 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346577
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.