DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and CG9003

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001097271.1 Gene:CG9003 / 36244 FlyBaseID:FBgn0033639 Length:651 Species:Drosophila melanogaster


Alignment Length:470 Identity:111/470 - (23%)
Similarity:187/470 - (39%) Gaps:137/470 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 EASQVYLSDGTVRSPFADTTIEKLPDKVLLHIFSYLSHREICRLARICRRWRQIAYDTRLWKNVS 78
            :.||.:|.    .:...|..|::||.:|||.:||||....:||.|::|:.|..:|.|...|:.::
  Fly   224 DQSQTFLG----ATELDDELIKQLPKEVLLRVFSYLDVVSLCRCAQVCKYWNVLALDGSSWQKIN 284

  Fly    79 L---RPEVSGLHVGSLEMLLQLISVRFGPTLRYIEL-PIELITHTVLHELSAKCPNLTHM----- 134
            |   :.::.|       .:::.||.|....|:.:.| ..:.:....:..|:..|.|:.|:     
  Fly   285 LFDFQRDIEG-------PVIENISQRCRGFLKSLSLRGCQSVGDQSVRTLANHCHNIEHLDLSDC 342

  Fly   135 --LLDFS-----------TAMQLHDFSEMQAFPTKLRYM---CVCLSEV------IFMEGFMRKI 177
              :.|.|           ||:.||..|.:.  ...|:|:   |..|.|:      :..|      
  Fly   343 KKITDISTQSISRYCSKLTAINLHSCSNIT--DNSLKYLSDGCPNLMEINVSWCHLISE------ 399

  Fly   178 YNFINGLEVLHLIGTYEKCEEEEEEIYEVIN---VHKLKSATPNLRVINLYGINFIDDSHIDAFS 239
                ||:|.  |.....|..:...:..:.||   :..|....|:|.|:||:....|.||.|...:
  Fly   400 ----NGVEA--LARGCVKLRKFSSKGCKQINDNAIMCLAKYCPDLMVLNLHSCETITDSSIRQLA 458

  Fly   240 SNCIQLECLAVNFCNKVTGSTLKTLIQRSKRLTCLLMNGTSLKSEFVMQA-----------EWDK 293
            :||.:|:.|.|:.|..:|..||.:|.|.:..|..|.::|....::...||           :.::
  Fly   459 ANCHKLQKLCVSKCADLTDLTLLSLSQHNHLLNTLEVSGCRNFTDIGFQALGRNCKYLERMDLEE 523

  Fly   294 CALQELDITATDLSTECLVDMLSRIPSLKFLSAGQINGFNDSVLKQWMESGTTRSLISLDLDSSD 358
            |: |..|:|...|:|.|        |||:                            .|.|...:
  Fly   524 CS-QITDLTLAHLATGC--------PSLE----------------------------KLTLSHCE 551

  Fly   359 NISDEGLLKFIQRQGHQLSACCLSGMPHITDQLWMSILPLLGNCKIIVMGTAEKLGVNIHVDQLM 423
            .|:|:|:       .|..:..|.:.:        :|:|. |.||.:|...|.|.|          
  Fly   552 LITDDGI-------RHLTTGSCAAEI--------LSVLE-LDNCPLITDRTLEHL---------- 590

  Fly   424 DTIASNCGNLERLEL 438
                .:|.||:|:||
  Fly   591 ----VSCHNLQRIEL 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 19/48 (40%)
leucine-rich repeat 131..156 CDD:275381 8/42 (19%)
leucine-rich repeat 157..175 CDD:275381 6/26 (23%)
leucine-rich repeat 219..244 CDD:275381 10/24 (42%)
leucine-rich repeat 245..270 CDD:275381 9/24 (38%)
leucine-rich repeat 271..295 CDD:275381 5/34 (15%)
leucine-rich repeat 296..320 CDD:275381 6/23 (26%)
leucine-rich repeat 321..348 CDD:275381 1/26 (4%)
leucine-rich repeat 349..375 CDD:275381 5/25 (20%)
leucine-rich repeat 376..403 CDD:275381 5/26 (19%)
leucine-rich repeat 405..432 CDD:275381 5/26 (19%)
CG9003NP_001097271.1 F-box-like 240..285 CDD:289689 18/44 (41%)
leucine-rich repeat 280..307 CDD:275381 6/33 (18%)
AMN1 <308..453 CDD:187754 34/158 (22%)
leucine-rich repeat 308..327 CDD:275381 2/18 (11%)
leucine-rich repeat 334..359 CDD:275381 3/24 (13%)
leucine-rich repeat 360..385 CDD:275381 8/26 (31%)
leucine-rich repeat 386..411 CDD:275381 7/36 (19%)
AMN1 <409..586 CDD:187754 52/229 (23%)
leucine-rich repeat 412..437 CDD:275381 3/24 (13%)
leucine-rich repeat 438..463 CDD:275381 10/24 (42%)
leucine-rich repeat 464..515 CDD:275381 14/50 (28%)
leucine-rich repeat 516..541 CDD:275381 7/33 (21%)
leucine-rich repeat 542..561 CDD:275381 6/53 (11%)
leucine-rich repeat 571..595 CDD:275381 10/38 (26%)
leucine-rich repeat 596..621 CDD:275381 4/6 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457971
Domainoid 1 1.000 41 1.000 Domainoid score I4815
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.