DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and Fbl6

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_610665.2 Gene:Fbl6 / 36201 FlyBaseID:FBgn0033609 Length:720 Species:Drosophila melanogaster


Alignment Length:497 Identity:108/497 - (21%)
Similarity:178/497 - (35%) Gaps:160/497 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 AVEASQVYLSDGTVRSPFADTTIEKLPDKVLLHIFSYLSHREIC-----RLARICRRWRQIAYDT 71
            |.||:    .|...:|.:|    :|||::||..||.:....:.|     ||.|:|..|||::...
  Fly   276 AAEAA----GDPVEQSVWA----QKLPEEVLFRIFEHAVDTQGCLPTLFRLGRVCSLWRQVSLRP 332

  Fly    72 RLWKNVSLRPEVSGLHVGSLEMLLQLISVRFG--PTLRYIELPIELITHTVLHELSAKCPNLT-- 132
            .||:.:.|...|...:...|: |...:..|..  ..|......|..| :..|.:||:.||||.  
  Fly   333 TLWRTMDLTTWVKEKYRTELK-LKWFVDNRCSACTDLNVSNWKISDI-NCFLAKLSSGCPNLAGI 395

  Fly   133 -----------HM--LLDFSTAMQLHDFS----EMQAFPTKLRYMCVCLSEVIFMEGFMRKIYNF 180
                       |:  |:|....:|..|.|    ||.|..:.:....:|                 
  Fly   396 TLSGWKGFTSDHLTYLVDNMHKLQRLDLSSINVEMNASKSAVGVNSLC----------------- 443

  Fly   181 INGLEVL-----HLIGTYEKCEEEEEEIYEVINVHKLKSATPNLRVINLYGINFIDDS----HID 236
             |.|:.:     ||...:.:.    ..|.:::.:  |.:..|||.:::|..:.....|    ||:
  Fly   444 -NALQTMGSRLTHLYLAHNRL----AGIPQIVGI--LSTHCPNLTLLDLSNVTTQATSHGVLHIE 501

  Fly   237 AFSSNCIQLECLAVNFCNKVTGSTLKTLIQRSKRLTCLLMNGTSLKSEFVMQAEWDKCALQELDI 301
            .....|.:|:.|.|. .:.:|.||..                        ||...|.....||: 
  Fly   502 KLQRGCQKLKVLRVT-NSHITPSTAS------------------------MQEIMDSPGFPELE- 540

  Fly   302 TATDLSTECLVDMLSRIPSLKFLSAGQINGFNDSVLKQWMESGTTRSLISLDLDSSDNISDEGLL 366
               :||...|.|. |||             .:|..|::.::|.:...|  ||:.:...::.|.|:
  Fly   541 ---ELSVAALTDE-SRI-------------ISDDHLQRILKSSSKLKL--LDVRNCTRLTHESLI 586

  Fly   367 K---------FIQRQGHQLSACCL-----SGMPHIT----------DQLWMSILPLLGNCKIIVM 407
            :         |       ||.|.:     ||:..|.          |..|.::...:.|.   :.
  Fly   587 RLPAWDIKHLF-------LSGCSVTRDMGSGLELIASKWAHSLIELDLAWANMQQPIDNA---LR 641

  Fly   408 GTAEK-----------LGVNIHVDQLMDTIASNCGNLERLEL 438
            ..|||           .|.::. |:.:..|.:||.|:..:.|
  Fly   642 ALAEKGRDSPLAHLNLCGSSVS-DEAVKEILTNCQNMSSINL 682

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 17/50 (34%)
leucine-rich repeat 131..156 CDD:275381 10/43 (23%)
leucine-rich repeat 157..175 CDD:275381 1/17 (6%)
leucine-rich repeat 219..244 CDD:275381 6/28 (21%)
leucine-rich repeat 245..270 CDD:275381 6/24 (25%)
leucine-rich repeat 271..295 CDD:275381 3/23 (13%)
leucine-rich repeat 296..320 CDD:275381 9/23 (39%)
leucine-rich repeat 321..348 CDD:275381 3/26 (12%)
leucine-rich repeat 349..375 CDD:275381 6/34 (18%)
leucine-rich repeat 376..403 CDD:275381 9/41 (22%)
leucine-rich repeat 405..432 CDD:275381 8/37 (22%)
Fbl6NP_610665.2 F-box-like 293..341 CDD:289689 16/47 (34%)
leucine-rich repeat 365..391 CDD:275381 7/26 (27%)
leucine-rich repeat 392..417 CDD:275381 4/24 (17%)
leucine-rich repeat 418..445 CDD:275381 7/44 (16%)
leucine-rich repeat 453..471 CDD:275381 3/21 (14%)
leucine-rich repeat 480..509 CDD:275381 6/28 (21%)
leucine-rich repeat 510..538 CDD:275381 9/52 (17%)
leucine-rich repeat 539..579 CDD:275381 14/59 (24%)
leucine-rich repeat 580..621 CDD:275381 9/47 (19%)
leucine-rich repeat 622..649 CDD:275381 6/29 (21%)
leucine-rich repeat 652..676 CDD:275381 5/24 (21%)
leucine-rich repeat 677..698 CDD:275381 1/6 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.