DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and Kdm2a

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:XP_038939767.1 Gene:Kdm2a / 361700 RGDID:1309419 Length:1166 Species:Rattus norvegicus


Alignment Length:347 Identity:72/347 - (20%)
Similarity:132/347 - (38%) Gaps:98/347 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KVLLHIFSYLSHREICRLARICRRWRQIAYDTRLWKNVSLR------PE-VSGLHVGSLEMLLQL 97
            :|.:.:|.|||.||:|...|:|:.|.:...|.|||..:.|.      |: :||:      :..|.
  Rat   900 EVWMSVFRYLSRRELCECMRVCKTWYKWCCDKRLWTKIDLSRCKAIVPQALSGI------IKRQP 958

  Fly    98 ISVRFGPTLRYIELPIELITHTVLHELSAKCPNLTHMLLDFSTAMQLHDFSEMQAFPTKLRYMCV 162
            :|         ::|....|:...|..|..:.|.|..:||...:      :|.:.|..|.   .|.
  Rat   959 VS---------LDLSWTNISKKQLTWLVNRLPGLKDLLLAGCS------WSAVSALSTS---SCP 1005

  Fly   163 CLSEVIFMEGFMRKIYNFINGLEVLHLIGTYEKCEEEEEEIYEVI----------NVHKLKSATP 217
            .|                 ..|::...:|.      ::.:|.:::          |..||:    
  Rat  1006 LL-----------------RTLDLRWAVGI------KDPQIRDLLTPPTDKPGQDNRSKLR---- 1043

  Fly   218 NLRVINLYGINFIDDSHIDAFSSNCIQLECLAVNFCNKVTGSTLKTLIQRSKRLTCLLMNGTSLK 282
            |:....|.|:: |.|:.:.....:...|..|.::.|:.:|.       |.|..||.:   |:|  
  Rat  1044 NMTDFRLAGLD-ITDATLRLIIRHMPLLSRLDLSHCSHLTD-------QSSNLLTAV---GSS-- 1095

  Fly   283 SEFVMQAEWDKCALQELDITATDLSTECLVDMLSRIPSLKFLSAGQINGFNDSVLKQWMESGTTR 347
                     .:.:|.||::...:..|:..:..|.||.::..:   .:.|     .||........
  Rat  1096 ---------TRYSLTELNMAGCNKLTDQTLFFLRRIANVTLI---DLRG-----CKQITRKACEH 1143

  Fly   348 SLISLDLDSSDNISDEGLLKFI 369
            .:..|.::|...:|||.|::.|
  Rat  1144 FISDLSINSLYCLSDEKLIQKI 1165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 15/39 (38%)
leucine-rich repeat 131..156 CDD:275381 5/24 (21%)
leucine-rich repeat 157..175 CDD:275381 2/17 (12%)
leucine-rich repeat 219..244 CDD:275381 4/24 (17%)
leucine-rich repeat 245..270 CDD:275381 6/24 (25%)
leucine-rich repeat 271..295 CDD:275381 4/23 (17%)
leucine-rich repeat 296..320 CDD:275381 7/23 (30%)
leucine-rich repeat 321..348 CDD:275381 3/26 (12%)
leucine-rich repeat 349..375 CDD:275381 7/21 (33%)
leucine-rich repeat 376..403 CDD:275381
leucine-rich repeat 405..432 CDD:275381
Kdm2aXP_038939767.1 cupin_RmlC-like 204..304 CDD:424065
JHD 309..>344 CDD:407680
CTD_KDM2A 455..522 CDD:412025
zf-CXXC <581..614 CDD:366873
PHD_KDM2A 624..680 CDD:277113
F-box-like 900..938 CDD:403981 15/37 (41%)
leucine-rich repeat 934..958 CDD:275381 5/29 (17%)
AMN1 936..1142 CDD:187754 50/286 (17%)
leucine-rich repeat 959..982 CDD:275381 5/31 (16%)
leucine-rich repeat 983..1006 CDD:275381 7/31 (23%)
leucine-rich repeat 1007..1044 CDD:275381 7/63 (11%)
leucine-rich repeat 1045..1069 CDD:275381 4/24 (17%)
leucine-rich repeat 1070..1099 CDD:275381 10/49 (20%)
leucine-rich repeat 1100..1124 CDD:275381 7/23 (30%)
leucine-rich repeat 1125..1144 CDD:275381 3/26 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.