DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and Fbxl17

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:XP_038939705.1 Gene:Fbxl17 / 316663 RGDID:1309773 Length:739 Species:Rattus norvegicus


Alignment Length:419 Identity:98/419 - (23%)
Similarity:166/419 - (39%) Gaps:94/419 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IEKLPDKVLLHIFSYLSHREICRLAR-ICRRWRQIAYDTRLWKNVSL--RPEVSGLHVGSLEMLL 95
            |.:||..:||.|||.||..|.|..|. :|:.||.:..|.:.||.:.|  |.:|:       :.||
  Rat   316 INQLPPSILLKIFSNLSLDERCLSASLVCKYWRDLCLDFQFWKQLDLSSRQQVT-------DELL 373

  Fly    96 QLISVRFGPTLRYIELPI---ELITHTVLHELSAKCPNLTHMLLDFSTAMQLHDFSEMQAFPTKL 157
            :.|:.|   :...:|:.|   ..::.:.:..|:.|||.|...     ||                
  Rat   374 EKIASR---SQNIVEINISDCRSMSDSGVCVLAFKCPGLLRY-----TA---------------- 414

  Fly   158 RYMCVCLSEVIFMEGFMRKIYNFINGLEVLHLIGTYEKCEEEEEEIYEVINVHKLKSATPNLRVI 222
             |.|..||:...:     .:.:....|:.:| :|..:|..:|        .:.:|.|....|:.|
  Rat   415 -YRCKQLSDTSII-----AVASHCPLLQKVH-VGNQDKLTDE--------GLKQLGSKCRELKDI 464

  Fly   223 NLYGINFIDDSHIDAFSSNCIQLECLAVNFCNKVTGSTLKTLIQRSKRLTCLLMNGTSLKSEFVM 287
            :......|.|..:...:.:|::|:.:.:.....||..::|...:....|.|:...|.|:.|:.|:
  Rat   465 HFGQCYKISDEGMVVIAKSCLKLQRIYMQENKLVTDQSVKAFAEHCPDLQCVGFMGCSVTSKGVI 529

  Fly   288 QAEWDKCALQELDIT-ATDLSTECLVDMLSRIPSLKFLSAGQINGFNDSVLKQWMESGTTRSLIS 351
            .....: .|..||:. .|:|..|.:::::.|..:|..|:.......||..::...:.|  :||..
  Rat   530 HLTKLR-NLSSLDLRHITELDNETVMEIVKRCKNLSSLNLCLNWIINDRCVEVIAKEG--QSLKE 591

  Fly   352 LDLDSSDNISDEGLLKFIQR----------QGHQLSACCL-------SGMP------HITDQLWM 393
            |.|.|. .|:|.|     ||          ..|.|..|..       ..:|      |:...| :
  Rat   592 LYLVSC-KITDYG-----QRGNSGAAGTAVPSHHLQHCPAGLQEDLGESLPDGLDPQHVRSHL-L 649

  Fly   394 SILP---LLGNCKIIVMGTAEKLGVNIHV 419
            ::.|   |||     ....|||.|....|
  Rat   650 TLFPCPGLLG-----PFSRAEKWGAGTGV 673

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 20/48 (42%)
leucine-rich repeat 131..156 CDD:275381 3/24 (13%)
leucine-rich repeat 157..175 CDD:275381 4/17 (24%)
leucine-rich repeat 219..244 CDD:275381 5/24 (21%)
leucine-rich repeat 245..270 CDD:275381 4/24 (17%)
leucine-rich repeat 271..295 CDD:275381 6/23 (26%)
leucine-rich repeat 296..320 CDD:275381 7/24 (29%)
leucine-rich repeat 321..348 CDD:275381 5/26 (19%)
leucine-rich repeat 349..375 CDD:275381 9/35 (26%)
leucine-rich repeat 376..403 CDD:275381 9/42 (21%)
leucine-rich repeat 405..432 CDD:275381 5/15 (33%)
Fbxl17XP_038939705.1 F-box-like 316..361 CDD:403981 19/44 (43%)
leucine-rich repeat 357..382 CDD:275381 9/34 (26%)
leucine-rich repeat 383..408 CDD:275381 5/24 (21%)
AMN1 406..568 CDD:187754 40/198 (20%)
leucine-rich repeat 409..434 CDD:275381 7/51 (14%)
leucine-rich repeat 435..460 CDD:275381 7/33 (21%)
leucine-rich repeat 461..486 CDD:275381 5/24 (21%)
leucine-rich repeat 487..512 CDD:275381 4/24 (17%)
leucine-rich repeat 513..536 CDD:275381 6/23 (26%)
leucine-rich repeat 537..562 CDD:275381 7/24 (29%)
leucine-rich repeat 563..588 CDD:275381 5/26 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346637
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.