DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and Fbxo33

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:XP_006240181.1 Gene:Fbxo33 / 314157 RGDID:1307543 Length:563 Species:Rattus norvegicus


Alignment Length:537 Identity:93/537 - (17%)
Similarity:194/537 - (36%) Gaps:163/537 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LPDKVLLHIFSYLSHREICRLARICRRWRQIAYDTRLWKNVSLRPEVSGLHVGSLEMLLQLISVR 101
            ||.::::||||:|...:..|.:..|..||:..:...||..:.:...||......||.|::    :
  Rat    74 LPSELIVHIFSFLPAPDRLRASASCSHWRECLFYPALWPQLRICLRVSPAEQPRLEFLMR----K 134

  Fly   102 FGPTLRYIELPIELITHTVLH---------------------------ELSAKCPNLTHMLLDFS 139
            .|..:|  ||.:|......|.                           :||::...:..:.|:. 
  Rat   135 CGWFVR--ELRVEFAAENYLSGGGGPGDGGGSGGGTDTGNGGEESEALQLSSRWLEVLRIYLEL- 196

  Fly   140 TAMQLHDFSEMQAFPTKLRYMCVCLS----------------EVIFMEGFMRKIYNFINGLEVLH 188
                               .:||.||                .|:..:|.:...|        |.
  Rat   197 -------------------VLCVLLSIRNNRNLQKFSLFGDISVVQQQGSLSSTY--------LS 234

  Fly   189 LIGTYEKCEEEEEEIYEVI--NVHKLK--SATPNLRVINLYGINFIDDS------HIDAFSSNC- 242
            .:....|..::.::::|.|  |..:||  |....|.::....::.:.:|      |:....:|. 
  Rat   235 RVDPDGKKIKQIQQLFEEILSNSRQLKWLSCGFMLEIVTPSSLSSLSNSIANTMEHLSLLDNNIP 299

  Fly   243 --------------IQLECLAVNFCNKVTGSTLKTLIQRS----KRLTCLLMNGT-SLKS--EFV 286
                          :.|..||::||: .|....:.|...:    :||:.|:.|.: .|||  ...
  Rat   300 GNSTLITAVELERFVNLRSLALDFCD-FTAEMARVLTDSNHVPLQRLSLLVHNASVMLKSLDNMP 363

  Fly   287 MQAEWD----KCALQELDITATDLSTECLVDMLSRIPSL--------KFLSAGQINGFNDSVLKQ 339
            ....|.    |.:...:.:.|.|:.:|.::.:|.  ||:        .:::.  ::|....::.:
  Rat   364 NDEHWKALSRKSSSLRVYLMAFDVKSEDMLKILK--PSIPLERVHFDSYVTC--VSGAIVDLISR 424

  Fly   340 WMESGTTRSLISLDL-------DSSDNISDEGLLKFIQRQGHQLSACCLSGMPHITDQLW----M 393
            ..:...|..::..|:       |.|||.:::.|:....| ..:|:...:.|.     .:|    :
  Rat   425 QYDKFLTHFILMNDMIDTSGFPDLSDNRNEDPLVLLAWR-CTKLTLLAIHGY-----TVWAHNLI 483

  Fly   394 SILPLLGNCKIIVMGTAEKLGVN-----------IHVDQLMDTIASNCG-------NLERLELRW 440
            :|..|.|:...::..|.|.:..:           :|  .|::.::...|       ::|.|.:..
  Rat   484 AIARLRGSDLKVLEVTEESIDFDQGELADQDVDPVH--NLLEQVSLGLGQSWHAVLDIESLSVFT 546

  Fly   441 DPDNLRFSDKSQKAIDI 457
            :|:...:.:....:.||
  Rat   547 EPNRHFYREMQSFSEDI 563

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 13/42 (31%)
leucine-rich repeat 131..156 CDD:275381 1/24 (4%)
leucine-rich repeat 157..175 CDD:275381 6/33 (18%)
leucine-rich repeat 219..244 CDD:275381 4/45 (9%)
leucine-rich repeat 245..270 CDD:275381 7/28 (25%)
leucine-rich repeat 271..295 CDD:275381 8/30 (27%)
leucine-rich repeat 296..320 CDD:275381 4/23 (17%)
leucine-rich repeat 321..348 CDD:275381 2/34 (6%)
leucine-rich repeat 349..375 CDD:275381 7/32 (22%)
leucine-rich repeat 376..403 CDD:275381 6/30 (20%)
leucine-rich repeat 405..432 CDD:275381 5/44 (11%)
Fbxo33XP_006240181.1 F-box-like 72..119 CDD:289689 13/44 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20933
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.