DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and Fbxl4

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001382505.1 Gene:Fbxl4 / 313101 RGDID:1305724 Length:621 Species:Rattus norvegicus


Alignment Length:392 Identity:93/392 - (23%)
Similarity:151/392 - (38%) Gaps:93/392 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SQVYLSDGTVRSPFADTTIEKLPDKVLLHIFSYLSHREICRLARICRRWRQIAYDTRLWKNVSLR 80
            |...|.||.....|     :|||.:::..|.::||..::||||:.||...|...|...:.:::|:
  Rat   267 SSATLGDGPSNGYF-----DKLPYELIQLILNHLSLPDLCRLAQTCRLLHQHCCDPLQYIHLNLQ 326

  Fly    81 PEVSGLHVGSLEML---------LQL--------ISV----RF----GPTLRYIELPI-ELITHT 119
            |..:.|...|||.|         |.|        |||    ||    |..|..:||.. ..:...
  Rat   327 PYWAKLDDTSLEFLQARCALVQWLNLSWTGNRGFISVSGFSRFLKVCGSELVRLELSCSHFLNDA 391

  Fly   120 VLHELSAKCPNLTHMLLD---------FSTAMQLHDFSEMQAFPTKLRYMCVCLSEVIFMEGFMR 175
            .|..:|..||||..:.|.         |....:|.....:..:.||:.            :..:.
  Rat   392 CLEVISEMCPNLQDLNLSSCDKLPPQAFGHIAKLRSLKRLILYRTKVE------------QTALL 444

  Fly   176 KIYNFINGLEVLHL-IGTYEKCEEEEEEIYEVINVHKLKSATPNLRVINLYGINFIDDSHIDAFS 239
            .|.||.  .|:.|| :|:....|:     |:|| ...:.:...:||.::|:....|.::.|...:
  Rat   445 SILNFC--AELQHLSLGSCVMIED-----YDVI-ASMIGAKCKSLRTLDLWRCKNITENGIAELA 501

  Fly   240 SNCIQLECLAVNFCNKVTGSTLKTLIQRSKRLTCLLMNGTSLKSEFVMQAEWDKCALQELDITAT 304
            |.|..||.|.:.:|..:..||           .|.......|.:            ||:|.:||.
  Rat   502 SGCALLEELDLGWCPTLQSST-----------GCFARLARQLPN------------LQKLFLTAN 543

  Fly   305 ----DLSTECLVDMLSRIPSLKFLSAGQINGFNDSVLKQWMESGTTRSLISLDLDSSDNISDEGL 365
                |...|.|....:|:..|..|....:   :.:.|::.:||  .:.|..||:.....|.:..:
  Rat   544 RSVCDTDIEELASNCTRLQQLDILGTRMV---SPASLRKLLES--CKDLSLLDVSFCSQIDNRAV 603

  Fly   366 LK 367
            |:
  Rat   604 LE 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 14/45 (31%)
leucine-rich repeat 131..156 CDD:275381 4/33 (12%)
leucine-rich repeat 157..175 CDD:275381 0/17 (0%)
leucine-rich repeat 219..244 CDD:275381 7/24 (29%)
leucine-rich repeat 245..270 CDD:275381 6/24 (25%)
leucine-rich repeat 271..295 CDD:275381 2/23 (9%)
leucine-rich repeat 296..320 CDD:275381 9/27 (33%)
leucine-rich repeat 321..348 CDD:275381 5/26 (19%)
leucine-rich repeat 349..375 CDD:275381 5/19 (26%)
leucine-rich repeat 376..403 CDD:275381
leucine-rich repeat 405..432 CDD:275381
Fbxl4NP_001382505.1 F-box-like 280..318 CDD:403981 15/42 (36%)
leucine-rich repeat 295..317 CDD:275381 9/21 (43%)
leucine-rich repeat 318..340 CDD:275381 6/21 (29%)
leucine-rich repeat 347..376 CDD:275381 8/28 (29%)
leucine-rich repeat 377..402 CDD:275381 6/24 (25%)
AMN1 394..601 CDD:187754 54/254 (21%)
leucine-rich repeat 403..427 CDD:275381 4/23 (17%)
leucine-rich repeat 428..452 CDD:275381 5/37 (14%)
leucine-rich repeat 453..480 CDD:275381 7/32 (22%)
leucine-rich repeat 481..506 CDD:275381 7/24 (29%)
leucine-rich repeat 507..534 CDD:275381 8/37 (22%)
leucine-rich repeat 535..560 CDD:275381 8/24 (33%)
leucine-rich repeat 561..586 CDD:275381 5/29 (17%)
leucine-rich repeat 587..612 CDD:275381 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.