DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and Kdm2b

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:XP_011246510.1 Gene:Kdm2b / 30841 MGIID:1354737 Length:1312 Species:Mus musculus


Alignment Length:361 Identity:74/361 - (20%)
Similarity:117/361 - (32%) Gaps:136/361 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PFADTTIEKLPDKVLLHIFSYLSHREICRLARICRRWRQIAYDTRLWKNVSLRPEVSGLHVGSLE 92
            |..|.....:..:|.:.:|||||||::|...|:||.|.:...|.|||..:.|.            
Mouse  1032 PLDDGAAHVMHREVWMAVFSYLSHRDLCVCMRVCRTWNRWCCDKRLWTRIDLN------------ 1084

  Fly    93 MLLQLISVRFGPTLRYIELPIELITHTVLHELSAKCPNLTHMLLDFSTAMQLHDFSEMQAFPTKL 157
                                              :|.::|.::|......|          |..|
Mouse  1085 ----------------------------------RCKSITPLMLSGIIRRQ----------PVSL 1105

  Fly   158 RYMCVCLSEVIFMEGFMRKIYNFINGLEVLHLIGTYEKCEEEEEEIYEVINVHKLKSATPNLRVI 222
            ......:|:        :::...||.|                                |.||.:
Mouse  1106 DLSWTNISK--------KQLSWLINRL--------------------------------PGLRDL 1130

  Fly   223 NLYGINFIDDSHIDAFSSNCIQLECLAVNFCNKVTGSTLKTLI------------QRSKRLTCLL 275
            .|.|.::|..|.:  .||:|..|..|.|.:...:..:.::.|:            .|||     |
Mouse  1131 VLSGCSWIAVSAL--CSSSCPLLRTLDVQWVEGLKDAQMRDLLSPPTDNRPGQMDNRSK-----L 1188

  Fly   276 MNGTSLKSEFVMQAEWDKCALQELDITATDLSTECLVDMLSRIPSLKFLSAGQINGFNDSVLKQW 340
            .|...|:             |..|||  ||:|...::   ..:|.|..|.....|..||..:...
Mouse  1189 RNIVELR-------------LAGLDI--TDVSLRLII---RHMPLLSKLQLSYCNHINDQSINLL 1235

  Fly   341 MESGTTR--SLISLDLDSSDNISDEGLLKFIQRQGH 374
            ...|||.  ||..::|...:.::|. .|.|.:|.|:
Mouse  1236 TAVGTTTRDSLTEVNLSDCNKVTDL-CLSFFKRCGN 1270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 17/45 (38%)
leucine-rich repeat 131..156 CDD:275381 4/24 (17%)
leucine-rich repeat 157..175 CDD:275381 2/17 (12%)
leucine-rich repeat 219..244 CDD:275381 9/24 (38%)
leucine-rich repeat 245..270 CDD:275381 6/36 (17%)
leucine-rich repeat 271..295 CDD:275381 3/23 (13%)
leucine-rich repeat 296..320 CDD:275381 7/23 (30%)
leucine-rich repeat 321..348 CDD:275381 8/28 (29%)
leucine-rich repeat 349..375 CDD:275381 7/26 (27%)
leucine-rich repeat 376..403 CDD:275381
leucine-rich repeat 405..432 CDD:275381
Kdm2bXP_011246510.1 JmjC 151..226 CDD:214721
cupin_like 198..297 CDD:389752
JHD 303..>338 CDD:375347
zf-CXXC <588..624 CDD:366873
PHD_KDM2B 634..695 CDD:277114
PTZ00449 <693..995 CDD:185628
F-box-like 1044..1082 CDD:372399 17/37 (46%)
leucine-rich repeat 1053..1075 CDD:275381 9/21 (43%)
leucine-rich repeat 1078..1102 CDD:275381 6/79 (8%)
AMN1 1083..1283 CDD:187754 55/310 (18%)
leucine-rich repeat 1103..1126 CDD:275381 5/62 (8%)
leucine-rich repeat 1127..1150 CDD:275381 9/24 (38%)
leucine-rich repeat 1151..1190 CDD:275381 8/43 (19%)
leucine-rich repeat 1191..1215 CDD:275381 8/41 (20%)
leucine-rich repeat 1216..1245 CDD:275381 8/28 (29%)
leucine-rich repeat 1246..1270 CDD:275381 6/24 (25%)
leucine-rich repeat 1271..1295 CDD:275381 74/361 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.