powered by:
Protein Alignment FipoQ and FBXL22
DIOPT Version :9
Sequence 1: | NP_733291.1 |
Gene: | FipoQ / 43475 |
FlyBaseID: | FBgn0039667 |
Length: | 515 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_011519770.1 |
Gene: | FBXL22 / 283807 |
HGNCID: | 27537 |
Length: | 260 |
Species: | Homo sapiens |
Alignment Length: | 58 |
Identity: | 16/58 - (27%) |
Similarity: | 24/58 - (41%) |
Gaps: | 0/58 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 217 PNLRVINLYGINFIDDSHIDAFSSNCIQLECLAVNFCNKVTGSTLKTLIQRSKRLTCL 274
|||..:.|.|...:.|..:......|.:|..|.:..|.:||..||..:....:.|..|
Human 149 PNLASVTLSGCGHVTDDCLARLLRCCPRLRALRLENCARVTNRTLAAVAADGRALQTL 206
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165153000 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1947 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.830 |
|
Return to query results.
Submit another query.