DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment FipoQ and FBXL22

DIOPT Version :9

Sequence 1:	NP_733291.1	Gene:	FipoQ / 43475	FlyBaseID:	FBgn0039667	Length:	515	Species:	Drosophila melanogaster
Sequence 2:	XP_011519770.1	Gene:	FBXL22 / 283807	HGNCID:	27537	Length:	260	Species:	Homo sapiens

Alignment Length:	58	Identity:	16/58 - (27%)
Similarity:	24/58 - (41%)	Gaps:	0/58 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   217 PNLRVINLYGINFIDDSHIDAFSSNCIQLECLAVNFCNKVTGSTLKTLIQRSKRLTCL 274
            |||..:.|.|...:.|..:......|.:|..|.:..|.:||..||..:....:.|..|
Human   149 PNLASVTLSGCGHVTDDCLARLLRCCPRLRALRLENCARVTNRTLAAVAADGRALQTL 206

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
FipoQ	NP_733291.1	F-box-like	34..80	CDD:289689
		leucine-rich repeat	131..156	CDD:275381
		leucine-rich repeat	157..175	CDD:275381
		leucine-rich repeat	219..244	CDD:275381	5/24 (21%)
		leucine-rich repeat	245..270	CDD:275381	7/24 (29%)
		leucine-rich repeat	271..295	CDD:275381	2/4 (50%)
		leucine-rich repeat	296..320	CDD:275381
		leucine-rich repeat	321..348	CDD:275381
		leucine-rich repeat	349..375	CDD:275381
		leucine-rich repeat	376..403	CDD:275381
		leucine-rich repeat	405..432	CDD:275381
FBXL22	XP_011519770.1	AMN1	<148..229	CDD:187754	16/58 (28%)
		leucine-rich repeat	151..176	CDD:275381	5/24 (21%)
		leucine-rich repeat	177..202	CDD:275381	7/24 (29%)
		leucine-rich repeat	203..228	CDD:275381	2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165153000
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1947
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.830