DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and FBXL2

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001336245.1 Gene:FBXL2 / 25827 HGNCID:13598 Length:454 Species:Homo sapiens


Alignment Length:449 Identity:102/449 - (22%)
Similarity:166/449 - (36%) Gaps:157/449 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 EKLPDKVLLHIFSYLSHREICRLARICRRWRQIAYDTRLWKNVSL---RPEVSGLHVGSLEMLLQ 96
            :|||.::||.|||:|....:||.|:|.:.|..:|.|...|:.:.|   :.:|.|           
Human    13 KKLPKELLLRIFSFLDIVTLCRCAQISKAWNILALDGSNWQRIDLFNFQTDVEG----------- 66

  Fly    97 LISVRFGPTLRYIELPIELITHTVLHELSAKCPNLTHMLLDFSTAMQLHDFSEMQAFPTKLRYMC 161
                                  .|:..:|.:|                                 
Human    67 ----------------------RVVENISKRC--------------------------------- 76

  Fly   162 VCLSEVIFMEGFMRKIYNFINGLEVLHLIGTYEKCEEEEEEIYEVINVHKLKSATPNLRVINLYG 226
                     .||:||                                             ::|.|
Human    77 ---------GGFLRK---------------------------------------------LSLRG 87

  Fly   227 INFIDDSHIDAFSSNCIQLECLAVNFCNKVTGSTLKTLIQRSKRL------TCLLMNGTSLK--S 283
            ...:.||.:..|:.||..:|.|.:|.|.|:|.||..:|.:...:|      :|:.:..:|||  |
Human    88 CIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKHLDLTSCVSITNSSLKGIS 152

  Fly   284 EFVMQAEWDKCALQELDITATDLSTECLVDMLSR-IPSLKFLSAGQINGFNDSVLKQWMESGTTR 347
            |.....|:       |:::..|..|:..::.|.| ...||.|.........|..||.  ......
Human   153 EGCRNLEY-------LNLSWCDQITKDGIEALVRGCRGLKALLLRGCTQLEDEALKH--IQNYCH 208

  Fly   348 SLISLDLDSSDNISDEGLLKFIQRQGHQLSACCLSGMPHITDQLWMSILPLLG-NCKIIVMGTAE 411
            .|:||:|.|...|:|||::: |.|..|:|.|.||||..::||    :.|..|| ||..:.:..|.
Human   209 ELVSLNLQSCSRITDEGVVQ-ICRGCHRLQALCLSGCSNLTD----ASLTALGLNCPRLQILEAA 268

  Fly   412 KLGVNIHV-DQLMDTIASNCGNLERLELRWDPDNLRFSDKSQKAIDILRVKCLKLRCMV 469
            :..   |: |.....:|.||..||:::|.   :.:..:|.:   :..|.:.|.||:.:|
Human   269 RCS---HLTDAGFTLLARNCHELEKMDLE---ECILITDST---LIQLSIHCPKLQALV 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 18/47 (38%)
leucine-rich repeat 131..156 CDD:275381 0/24 (0%)
leucine-rich repeat 157..175 CDD:275381 2/17 (12%)
leucine-rich repeat 219..244 CDD:275381 7/24 (29%)
leucine-rich repeat 245..270 CDD:275381 9/24 (38%)
leucine-rich repeat 271..295 CDD:275381 8/31 (26%)
leucine-rich repeat 296..320 CDD:275381 5/24 (21%)
leucine-rich repeat 321..348 CDD:275381 6/26 (23%)
leucine-rich repeat 349..375 CDD:275381 11/25 (44%)
leucine-rich repeat 376..403 CDD:275381 12/27 (44%)
leucine-rich repeat 405..432 CDD:275381 6/27 (22%)
FBXL2NP_001336245.1 F-box-like 15..56 CDD:315592 16/40 (40%)
leucine-rich repeat 52..79 CDD:275381 7/101 (7%)
AMN1 <76..223 CDD:332986 46/242 (19%)
leucine-rich repeat 80..99 CDD:275381 6/63 (10%)
leucine-rich repeat 106..131 CDD:275381 9/24 (38%)
leucine-rich repeat 132..157 CDD:275381 7/24 (29%)
leucine-rich repeat 158..183 CDD:275381 6/31 (19%)
AMN1 168..398 CDD:332986 49/167 (29%)
leucine-rich repeat 184..209 CDD:275381 6/26 (23%)
leucine-rich repeat 210..235 CDD:275381 11/25 (44%)
leucine-rich repeat 236..261 CDD:275381 13/28 (46%)
leucine-rich repeat 262..287 CDD:275381 6/27 (22%)
leucine-rich repeat 288..313 CDD:275381 6/30 (20%)
leucine-rich repeat 314..364 CDD:275381 2/5 (40%)
leucine-rich repeat 374..393 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153042
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.