DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and FBXO33

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_976046.1 Gene:FBXO33 / 254170 HGNCID:19833 Length:555 Species:Homo sapiens


Alignment Length:522 Identity:98/522 - (18%)
Similarity:198/522 - (37%) Gaps:138/522 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LPDKVLLHIFSYLSHREICRLARICRRWRQIAYDTRLWKNVSLRPEVSGLHVGSLEMLLQLISVR 101
            ||.::::||||:|...:..|.:..|..||:..:...||..:.:...||......||.|::    :
Human    71 LPSELIVHIFSFLPAPDRLRASASCSHWRECLFYPALWPQLRICLRVSPAEQPRLEFLMR----K 131

  Fly   102 FGPTLRYIELPIELITHTVLHELSAKCPNLTHMLLDFSTAMQLHDFSEMQAFPTKLRY------- 159
            .|..:|  ||.:|....   :.||...|.      |...|.......|::|.....|:       
Human   132 CGWFVR--ELRVEFAAE---NYLSGGGPG------DGGGADTGTGGEEVEALQLSARWLEVLRTY 185

  Fly   160 ----MCVCLSEVIFMEGFMRKIYNFINGLEVLH----LIGTY--------EKCEEEEEEIYEVI- 207
                :||.:|  |.....::| ::....:.||.    |..||        :|.::.::...|:: 
Human   186 LELVLCVLVS--IRNNRNLQK-FSLFGDISVLQQQGSLSNTYLSKVDPDGKKIKQIQQLFEEILS 247

  Fly   208 NVHKLK--SATPNLRVINLYGINFIDDS------HIDAFSSNC---------------IQLECLA 249
            |..:||  |....|.::....::.:.::      |:....:|.               :.|..||
Human   248 NSRQLKWLSCGFMLEIVTPTSLSSLSNAVANTMEHLSLLDNNIPGNSTLITAVELERFVNLHSLA 312

  Fly   250 VNFCNKVTGSTLKTLIQRS----KRLTCLLMNGTSLKSEFVMQAEWDKCALQE------------ 298
            ::||: .|....:.|...:    :||:.|:.|.:      ||....|.....|            
Human   313 LDFCD-FTAEMARVLTDSNHVPLQRLSLLVHNVS------VMHKSLDNMPNDEHWKALSRKSTSF 370

  Fly   299 -LDITATDLSTECLVDMLSRIPSL--------KFLSAGQINGFNDSVLKQWMESGTTRSLISLDL 354
             :.|.|.|:.:|.::.:|.  ||:        .:::.  ::|....::.:..:...|..::..|:
Human   371 RVYIMAFDIKSEDMLKILK--PSIPLERIHFDSYITC--VSGAIVDLISRQYDKFLTHFILMNDV 431

  Fly   355 -------DSSDNISDEGLLKFIQRQGHQLSACCLSGMPHITDQLW----MSILPLLGNCKIIVMG 408
                   |.|||.:::.|:....| ..:||...:.|.     .:|    ::|..|.|:...::..
Human   432 IDTSGFPDLSDNRNEDPLVLLAWR-CTKLSLLAIHGY-----TVWAHNLIAIARLRGSDLKVLEV 490

  Fly   409 TAEKLGVN-----------IHVDQLMDTIASNCG-------NLERLELRWDPDNLRFSDKSQKAI 455
            |.|.:..:           :|  .|::.::...|       ::|.|.:..:|:...:.:....:.
Human   491 TEESIDFDQGELADQDVDPVH--NLIEQVSLGLGQPWHAVMDIESLSVFTEPNRHFYREMQSFSE 553

  Fly   456 DI 457
            ||
Human   554 DI 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 13/42 (31%)
leucine-rich repeat 131..156 CDD:275381 4/24 (17%)
leucine-rich repeat 157..175 CDD:275381 5/28 (18%)
leucine-rich repeat 219..244 CDD:275381 3/45 (7%)
leucine-rich repeat 245..270 CDD:275381 7/28 (25%)
leucine-rich repeat 271..295 CDD:275381 6/23 (26%)
leucine-rich repeat 296..320 CDD:275381 6/36 (17%)
leucine-rich repeat 321..348 CDD:275381 2/34 (6%)
leucine-rich repeat 349..375 CDD:275381 7/32 (22%)
leucine-rich repeat 376..403 CDD:275381 7/30 (23%)
leucine-rich repeat 405..432 CDD:275381 5/44 (11%)
FBXO33NP_976046.1 F-box-like 69..116 CDD:289689 13/44 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20933
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.