DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and FBXL7

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_036436.1 Gene:FBXL7 / 23194 HGNCID:13604 Length:491 Species:Homo sapiens


Alignment Length:396 Identity:84/396 - (21%)
Similarity:146/396 - (36%) Gaps:138/396 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TIEKLPDKVLLHIFSYLSHREICRLARICRRWRQIAYDTRLWKNVSL------------------ 79
            :|::|||..::.|||:|...::||.||:||||..:|:|.|||:.:.|                  
Human   113 SIDRLPDHSMVQIFSFLPTNQLCRCARVCRRWYNLAWDPRLWRTIRLTGETINVDRALKVLTRRL 177

  Fly    80 --------------------------------------RPEVSGLHVGSLEMLLQLI-------- 98
                                                  |.||||.:..|.|.:..::        
Human   178 CQDTPNVCLMLETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNLEH 242

  Fly    99 ------------------SVRFGP------TLRYIEL-PIELITHTVLHELSAKCPNLTHMLLDF 138
                              |::..|      ::||::: ...::....||.::|.|..|||:.|  
Human   243 LDVSGCSKVTCISLTREASIKLSPLHGKQISIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYL-- 305

  Fly   139 STAMQLHDFSEMQAFPTKLRYMCV-C-------LSEVIFMEGF----MRKIYNFINGLEVLHLIG 191
            ...::|.|        ..|||:.: |       :|:..|:..|    :.|:.:.:..|.:.|   
Human   306 RRCVRLTD--------EGLRYLVIYCASIKELSVSDCRFVSDFGLREIAKLESRLRYLSIAH--- 359

  Fly   192 TYEKCEEEEEEIYEVINVHKLKSATPNLRVINLYGINFIDDSHIDAFSSNCIQLECLAVNFCNKV 256
                |....:     :.:..:......||.:|..|...|.|..::..:.||.:|:.|.:..|..|
Human   360 ----CGRVTD-----VGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIGKCPLV 415

  Fly   257 TGSTLKTLIQRSKRLTCLLMNGTSLKSEFVMQAEWDKCALQELDITAT---DLSTECLVDMLSRI 318
            :.:.|:.|     .|.|..:...||||       .:....|.|.|.|.   ||.|..:.|....:
Human   416 SDTGLECL-----ALNCFNLKRLSLKS-------CESITGQGLQIVAANCFDLQTLNVQDCEVSV 468

  Fly   319 PSLKFL 324
            .:|:|:
Human   469 EALRFV 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 22/101 (22%)
leucine-rich repeat 131..156 CDD:275381 6/24 (25%)
leucine-rich repeat 157..175 CDD:275381 7/29 (24%)
leucine-rich repeat 219..244 CDD:275381 8/24 (33%)
leucine-rich repeat 245..270 CDD:275381 6/24 (25%)
leucine-rich repeat 271..295 CDD:275381 6/23 (26%)
leucine-rich repeat 296..320 CDD:275381 8/26 (31%)
leucine-rich repeat 321..348 CDD:275381 2/4 (50%)
leucine-rich repeat 349..375 CDD:275381
leucine-rich repeat 376..403 CDD:275381
leucine-rich repeat 405..432 CDD:275381
FBXL7NP_036436.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..79
F-box-like 114..157 CDD:372399 21/42 (50%)
leucine-rich repeat 129..151 CDD:275381 10/21 (48%)
leucine-rich repeat 154..187 CDD:275381 2/32 (6%)
LRR 1 170..195 0/24 (0%)
AMN1 <185..366 CDD:187754 32/202 (16%)
leucine-rich repeat 188..213 CDD:275381 0/24 (0%)
LRR 2 196..221 3/24 (13%)
leucine-rich repeat 214..234 CDD:275381 7/19 (37%)
LRR 3 222..247 2/24 (8%)
leucine-rich repeat 240..273 CDD:275381 2/32 (6%)
LRR 4 253..281 4/27 (15%)
leucine-rich repeat 274..299 CDD:275381 6/24 (25%)
LRR 5 282..307 8/26 (31%)
AMN1 297..464 CDD:187754 45/200 (23%)
leucine-rich repeat 300..325 CDD:275381 10/34 (29%)
LRR 6 308..333 6/32 (19%)
leucine-rich repeat 326..351 CDD:275381 4/24 (17%)
LRR 7 334..359 4/24 (17%)
leucine-rich repeat 352..377 CDD:275381 3/36 (8%)
LRR 8 360..385 4/29 (14%)
leucine-rich repeat 378..403 CDD:275381 8/24 (33%)
LRR 9 386..411 6/24 (25%)
leucine-rich repeat 404..429 CDD:275381 8/29 (28%)
LRR 10 412..437 8/29 (28%)
leucine-rich repeat 430..453 CDD:275381 8/29 (28%)
LRR 11 438..463 7/24 (29%)
leucine-rich repeat 456..480 CDD:275381 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153067
Domainoid 1 1.000 59 1.000 Domainoid score I10693
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.