Sequence 1: | NP_733291.1 | Gene: | FipoQ / 43475 | FlyBaseID: | FBgn0039667 | Length: | 515 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_036436.1 | Gene: | FBXL7 / 23194 | HGNCID: | 13604 | Length: | 491 | Species: | Homo sapiens |
Alignment Length: | 396 | Identity: | 84/396 - (21%) |
---|---|---|---|
Similarity: | 146/396 - (36%) | Gaps: | 138/396 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 TIEKLPDKVLLHIFSYLSHREICRLARICRRWRQIAYDTRLWKNVSL------------------ 79
Fly 80 --------------------------------------RPEVSGLHVGSLEMLLQLI-------- 98
Fly 99 ------------------SVRFGP------TLRYIEL-PIELITHTVLHELSAKCPNLTHMLLDF 138
Fly 139 STAMQLHDFSEMQAFPTKLRYMCV-C-------LSEVIFMEGF----MRKIYNFINGLEVLHLIG 191
Fly 192 TYEKCEEEEEEIYEVINVHKLKSATPNLRVINLYGINFIDDSHIDAFSSNCIQLECLAVNFCNKV 256
Fly 257 TGSTLKTLIQRSKRLTCLLMNGTSLKSEFVMQAEWDKCALQELDITAT---DLSTECLVDMLSRI 318
Fly 319 PSLKFL 324 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
FipoQ | NP_733291.1 | F-box-like | 34..80 | CDD:289689 | 22/101 (22%) |
leucine-rich repeat | 131..156 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 157..175 | CDD:275381 | 7/29 (24%) | ||
leucine-rich repeat | 219..244 | CDD:275381 | 8/24 (33%) | ||
leucine-rich repeat | 245..270 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 271..295 | CDD:275381 | 6/23 (26%) | ||
leucine-rich repeat | 296..320 | CDD:275381 | 8/26 (31%) | ||
leucine-rich repeat | 321..348 | CDD:275381 | 2/4 (50%) | ||
leucine-rich repeat | 349..375 | CDD:275381 | |||
leucine-rich repeat | 376..403 | CDD:275381 | |||
leucine-rich repeat | 405..432 | CDD:275381 | |||
FBXL7 | NP_036436.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..79 | ||
F-box-like | 114..157 | CDD:372399 | 21/42 (50%) | ||
leucine-rich repeat | 129..151 | CDD:275381 | 10/21 (48%) | ||
leucine-rich repeat | 154..187 | CDD:275381 | 2/32 (6%) | ||
LRR 1 | 170..195 | 0/24 (0%) | |||
AMN1 | <185..366 | CDD:187754 | 32/202 (16%) | ||
leucine-rich repeat | 188..213 | CDD:275381 | 0/24 (0%) | ||
LRR 2 | 196..221 | 3/24 (13%) | |||
leucine-rich repeat | 214..234 | CDD:275381 | 7/19 (37%) | ||
LRR 3 | 222..247 | 2/24 (8%) | |||
leucine-rich repeat | 240..273 | CDD:275381 | 2/32 (6%) | ||
LRR 4 | 253..281 | 4/27 (15%) | |||
leucine-rich repeat | 274..299 | CDD:275381 | 6/24 (25%) | ||
LRR 5 | 282..307 | 8/26 (31%) | |||
AMN1 | 297..464 | CDD:187754 | 45/200 (23%) | ||
leucine-rich repeat | 300..325 | CDD:275381 | 10/34 (29%) | ||
LRR 6 | 308..333 | 6/32 (19%) | |||
leucine-rich repeat | 326..351 | CDD:275381 | 4/24 (17%) | ||
LRR 7 | 334..359 | 4/24 (17%) | |||
leucine-rich repeat | 352..377 | CDD:275381 | 3/36 (8%) | ||
LRR 8 | 360..385 | 4/29 (14%) | |||
leucine-rich repeat | 378..403 | CDD:275381 | 8/24 (33%) | ||
LRR 9 | 386..411 | 6/24 (25%) | |||
leucine-rich repeat | 404..429 | CDD:275381 | 8/29 (28%) | ||
LRR 10 | 412..437 | 8/29 (28%) | |||
leucine-rich repeat | 430..453 | CDD:275381 | 8/29 (28%) | ||
LRR 11 | 438..463 | 7/24 (29%) | |||
leucine-rich repeat | 456..480 | CDD:275381 | 5/19 (26%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165153067 | |
Domainoid | 1 | 1.000 | 59 | 1.000 | Domainoid score | I10693 |
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1027299at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.750 |