DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and KDM2A

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_036440.1 Gene:KDM2A / 22992 HGNCID:13606 Length:1162 Species:Homo sapiens


Alignment Length:347 Identity:72/347 - (20%)
Similarity:132/347 - (38%) Gaps:98/347 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KVLLHIFSYLSHREICRLARICRRWRQIAYDTRLWKNVSLR------PE-VSGLHVGSLEMLLQL 97
            :|.:.:|.|||.||:|...|:|:.|.:...|.|||..:.|.      |: :||:      :..|.
Human   896 EVWMSVFRYLSRRELCECMRVCKTWYKWCCDKRLWTKIDLSRCKAIVPQALSGI------IKRQP 954

  Fly    98 ISVRFGPTLRYIELPIELITHTVLHELSAKCPNLTHMLLDFSTAMQLHDFSEMQAFPTKLRYMCV 162
            :|         ::|....|:...|..|..:.|.|..:||...:      :|.:.|..|.   .|.
Human   955 VS---------LDLSWTNISKKQLTWLVNRLPGLKDLLLAGCS------WSAVSALSTS---SCP 1001

  Fly   163 CLSEVIFMEGFMRKIYNFINGLEVLHLIGTYEKCEEEEEEIYEVI----------NVHKLKSATP 217
            .|                 ..|::...:|.      ::.:|.:::          |..||:    
Human  1002 LL-----------------RTLDLRWAVGI------KDPQIRDLLTPPADKPGQDNRSKLR---- 1039

  Fly   218 NLRVINLYGINFIDDSHIDAFSSNCIQLECLAVNFCNKVTGSTLKTLIQRSKRLTCLLMNGTSLK 282
            |:....|.|:: |.|:.:.....:...|..|.::.|:.:|.       |.|..||.:   |:|  
Human  1040 NMTDFRLAGLD-ITDATLRLIIRHMPLLSRLDLSHCSHLTD-------QSSNLLTAV---GSS-- 1091

  Fly   283 SEFVMQAEWDKCALQELDITATDLSTECLVDMLSRIPSLKFLSAGQINGFNDSVLKQWMESGTTR 347
                     .:.:|.||::...:..|:..:..|.||.::..:   .:.|     .||........
Human  1092 ---------TRYSLTELNMAGCNKLTDQTLIYLRRIANVTLI---DLRG-----CKQITRKACEH 1139

  Fly   348 SLISLDLDSSDNISDEGLLKFI 369
            .:..|.::|...:|||.|::.|
Human  1140 FISDLSINSLYCLSDEKLIQKI 1161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 15/39 (38%)
leucine-rich repeat 131..156 CDD:275381 5/24 (21%)
leucine-rich repeat 157..175 CDD:275381 2/17 (12%)
leucine-rich repeat 219..244 CDD:275381 4/24 (17%)
leucine-rich repeat 245..270 CDD:275381 6/24 (25%)
leucine-rich repeat 271..295 CDD:275381 4/23 (17%)
leucine-rich repeat 296..320 CDD:275381 7/23 (30%)
leucine-rich repeat 321..348 CDD:275381 3/26 (12%)
leucine-rich repeat 349..375 CDD:275381 7/21 (33%)
leucine-rich repeat 376..403 CDD:275381
leucine-rich repeat 405..432 CDD:275381
KDM2ANP_036440.1 cupin_like 199..299 CDD:328732
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 367..389
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 532..557
zf-CXXC <576..609 CDD:251032
PHD_KDM2A 619..675 CDD:277113
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 704..789
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 839..887
F-box-like 896..934 CDD:315592 15/37 (41%)
leucine-rich repeat 930..954 CDD:275381 5/29 (17%)
AMN1 932..1138 CDD:332986 50/286 (17%)
leucine-rich repeat 955..978 CDD:275381 5/31 (16%)
LRR 1 961..982 5/20 (25%)
leucine-rich repeat 979..1002 CDD:275381 7/31 (23%)
LRR 2 984..1010 7/51 (14%)
leucine-rich repeat 1003..1040 CDD:275381 7/63 (11%)
leucine-rich repeat 1041..1065 CDD:275381 4/24 (17%)
LRR 3 1048..1073 5/25 (20%)
leucine-rich repeat 1066..1095 CDD:275381 10/49 (20%)
LRR 4 1074..1103 11/49 (22%)
leucine-rich repeat 1096..1120 CDD:275381 7/23 (30%)
LRR 5 1104..1128 4/26 (15%)
leucine-rich repeat 1121..1140 CDD:275381 3/26 (12%)
LRR 6 1129..1156 6/26 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.