DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and Kdm2a

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001001984.2 Gene:Kdm2a / 225876 MGIID:1354736 Length:1161 Species:Mus musculus


Alignment Length:347 Identity:71/347 - (20%)
Similarity:132/347 - (38%) Gaps:98/347 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KVLLHIFSYLSHREICRLARICRRWRQIAYDTRLWKNVSLR------PE-VSGLHVGSLEMLLQL 97
            :|.:.:|.|||.:|:|...|:|:.|.:...|.|||..:.|.      |: :||:      :..|.
Mouse   895 EVWMSVFRYLSRKELCECMRVCKTWYKWCCDKRLWTKIDLSRCKAIVPQALSGI------IKRQP 953

  Fly    98 ISVRFGPTLRYIELPIELITHTVLHELSAKCPNLTHMLLDFSTAMQLHDFSEMQAFPTKLRYMCV 162
            :|         ::|....|:...|..|..:.|.|..:||...:      :|.:.|..|.   .|.
Mouse   954 VS---------LDLSWTNISKKQLTWLVNRLPGLKDLLLAGCS------WSAVSALSTS---SCP 1000

  Fly   163 CLSEVIFMEGFMRKIYNFINGLEVLHLIGTYEKCEEEEEEIYEVI----------NVHKLKSATP 217
            .|                 ..|::...:|.      ::.:|.:::          |..||:    
Mouse  1001 LL-----------------RTLDLRWAVGI------KDPQIRDLLTPPTDKPGQDNRSKLR---- 1038

  Fly   218 NLRVINLYGINFIDDSHIDAFSSNCIQLECLAVNFCNKVTGSTLKTLIQRSKRLTCLLMNGTSLK 282
            |:....|.|:: |.|:.:.....:...|..|.::.|:.:|.       |.|..||.:   |:|  
Mouse  1039 NMTDFRLAGLD-ITDATLRLIIRHMPLLSRLDLSHCSHLTD-------QSSNLLTAV---GSS-- 1090

  Fly   283 SEFVMQAEWDKCALQELDITATDLSTECLVDMLSRIPSLKFLSAGQINGFNDSVLKQWMESGTTR 347
                     .:.:|.||::...:..|:..:..|.||.::..:   .:.|     .||........
Mouse  1091 ---------TRYSLTELNMAGCNKLTDQTLFFLRRIANVTLI---DLRG-----CKQITRKACEH 1138

  Fly   348 SLISLDLDSSDNISDEGLLKFI 369
            .:..|.::|...:|||.|::.|
Mouse  1139 FISDLSINSLYCLSDEKLIQKI 1160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 14/39 (36%)
leucine-rich repeat 131..156 CDD:275381 5/24 (21%)
leucine-rich repeat 157..175 CDD:275381 2/17 (12%)
leucine-rich repeat 219..244 CDD:275381 4/24 (17%)
leucine-rich repeat 245..270 CDD:275381 6/24 (25%)
leucine-rich repeat 271..295 CDD:275381 4/23 (17%)
leucine-rich repeat 296..320 CDD:275381 7/23 (30%)
leucine-rich repeat 321..348 CDD:275381 3/26 (12%)
leucine-rich repeat 349..375 CDD:275381 7/21 (33%)
leucine-rich repeat 376..403 CDD:275381
leucine-rich repeat 405..432 CDD:275381
Kdm2aNP_001001984.2 cupin_like 199..299 CDD:389752
JHD 304..>339 CDD:375347
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 419..445
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 532..557
zf-CXXC <576..609 CDD:366873
PHD_KDM2A 619..675 CDD:277113
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 705..789
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 840..886
F-box-like 895..933 CDD:372399 14/37 (38%)
leucine-rich repeat 929..953 CDD:275381 5/29 (17%)
AMN1 931..1137 CDD:187754 50/286 (17%)
leucine-rich repeat 954..977 CDD:275381 5/31 (16%)
LRR 1 960..981 5/20 (25%)
leucine-rich repeat 978..1001 CDD:275381 7/31 (23%)
LRR 2 983..1009 7/51 (14%)
leucine-rich repeat 1002..1039 CDD:275381 7/63 (11%)
leucine-rich repeat 1040..1064 CDD:275381 4/24 (17%)
LRR 3 1047..1072 5/25 (20%)
leucine-rich repeat 1065..1094 CDD:275381 10/49 (20%)
LRR 4 1073..1102 11/49 (22%)
leucine-rich repeat 1095..1119 CDD:275381 7/23 (30%)
LRR 5 1103..1127 4/26 (15%)
leucine-rich repeat 1120..1139 CDD:275381 3/26 (12%)
LRR 6 1128..1155 6/26 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.