DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and Fbxl21

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001333661.1 Gene:Fbxl21 / 213311 MGIID:2442921 Length:460 Species:Mus musculus


Alignment Length:341 Identity:71/341 - (20%)
Similarity:119/341 - (34%) Gaps:107/341 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ASQVYLSDGTVRSPFADTTIEKLPDKVLLHIFSYLSHREICRLARICRRWRQIAYDTRLWK--NV 77
            |..|.|..||            ||..|:|.||.||...:..|.:.:||||.::.:...||:  ..
Mouse    61 ALSVLLDWGT------------LPHHVILQIFQYLPLIDRARASSVCRRWNEVFHIPDLWRKFEF 113

  Fly    78 SLRPEVSGLHVGSLEMLLQLISVRFGPTLRYIELPIELITHT------VLHELSAKCPNLTHMLL 136
            .|....:.....:...|:|.|..:....|:|:...::..|.:      :|.:| ..|...|..|:
Mouse   114 ELNQSATSYFKSTHPDLIQQIIKKHAAHLQYVSFKVDSSTESAEAACDILSQL-VNCSIQTLGLI 177

  Fly   137 DFSTAMQLHDFSEMQAFPTKLRYMCVCLSEVIFMEGFMRKIYNFINGLEVLHLIGTYEKCEEEEE 201
              |||              |..:|.|..|             :|::.|.|:              
Mouse   178 --STA--------------KPSFMNVPKS-------------HFVSALTVV-------------- 199

  Fly   202 EIYEVINVHKLKSATPNLRVINLYGINFIDDSHID------AFSSNCIQLECLAVNFCNKVTGST 260
                .:|...|.|..             |:|:.:|      ..::|...|..|.::.|..|:...
Mouse   200 ----FVNSKSLSSIK-------------IEDTPVDDPSLKILVANNSDTLRLLKMSSCPHVSSDG 247

  Fly   261 LKTLIQRSKRLTCLLMNGTSLKSEFVMQAEWDKCALQELDITATDLSTECL-VDMLSRIPSLKFL 324
            :..:....:.|..|.:|...|..|.::       ||.    :.|.::.|.| :|::|..|     
Mouse   248 ILCVADHCQGLRELALNYYILSDEILL-------ALS----SETHVNLEHLRIDVVSENP----- 296

  Fly   325 SAGQINGFNDSVLKQW 340
              |||. |:....:.|
Mouse   297 --GQIK-FHSIKKRSW 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 15/47 (32%)
leucine-rich repeat 131..156 CDD:275381 5/24 (21%)
leucine-rich repeat 157..175 CDD:275381 3/17 (18%)
leucine-rich repeat 219..244 CDD:275381 4/30 (13%)
leucine-rich repeat 245..270 CDD:275381 4/24 (17%)
leucine-rich repeat 271..295 CDD:275381 5/23 (22%)
leucine-rich repeat 296..320 CDD:275381 6/24 (25%)
leucine-rich repeat 321..348 CDD:275381 5/20 (25%)
leucine-rich repeat 349..375 CDD:275381
leucine-rich repeat 376..403 CDD:275381
leucine-rich repeat 405..432 CDD:275381
Fbxl21NP_001333661.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843151
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.