Sequence 1: | NP_733291.1 | Gene: | FipoQ / 43475 | FlyBaseID: | FBgn0039667 | Length: | 515 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001106873.1 | Gene: | AMN1 / 196394 | HGNCID: | 27281 | Length: | 258 | Species: | Homo sapiens |
Alignment Length: | 247 | Identity: | 51/247 - (20%) |
---|---|---|---|
Similarity: | 95/247 - (38%) | Gaps: | 43/247 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 129 PNLTHMLLDFSTAMQLHDFS----EMQAFPTKLRYMCVCLSEVIFMEGFMRKIYNFINGLEVLH- 188
Fly 189 LIGTYE--KCEEEEEEIYEVINVHKLK----SATPNLRV-INLYGINFI---------------- 230
Fly 231 --DDSHIDAFSSNCIQLECLAVNFCNKVTGSTLKTLIQRSKRLTCLLMNGTSLKSEFVMQAEWDK 293
Fly 294 CA--LQELD----ITATDLSTECLVDMLSRIPSLKFLSAGQINGFNDSVLKQ 339 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
FipoQ | NP_733291.1 | F-box-like | 34..80 | CDD:289689 | |
leucine-rich repeat | 131..156 | CDD:275381 | 5/28 (18%) | ||
leucine-rich repeat | 157..175 | CDD:275381 | 3/17 (18%) | ||
leucine-rich repeat | 219..244 | CDD:275381 | 8/43 (19%) | ||
leucine-rich repeat | 245..270 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 271..295 | CDD:275381 | 4/23 (17%) | ||
leucine-rich repeat | 296..320 | CDD:275381 | 6/27 (22%) | ||
leucine-rich repeat | 321..348 | CDD:275381 | 6/19 (32%) | ||
leucine-rich repeat | 349..375 | CDD:275381 | |||
leucine-rich repeat | 376..403 | CDD:275381 | |||
leucine-rich repeat | 405..432 | CDD:275381 | |||
AMN1 | NP_001106873.1 | AMN1 | 37..257 | CDD:187754 | 45/214 (21%) |
leucine-rich repeat | 63..86 | CDD:275381 | 3/22 (14%) | ||
leucine-rich repeat | 87..116 | CDD:275381 | 7/28 (25%) | ||
leucine-rich repeat | 117..142 | CDD:275381 | 4/24 (17%) | ||
leucine-rich repeat | 143..168 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 169..195 | CDD:275381 | 6/25 (24%) | ||
leucine-rich repeat | 196..221 | CDD:275381 | 5/24 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |