DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and AMN1

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001106873.1 Gene:AMN1 / 196394 HGNCID:27281 Length:258 Species:Homo sapiens


Alignment Length:247 Identity:51/247 - (20%)
Similarity:95/247 - (38%) Gaps:43/247 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 PNLTHMLLDFSTAMQLHDFS----EMQAFPTKLRYMCVCLSEVIFMEGFMRKIYNFINGLEVLH- 188
            |.....|||......:.:.|    :::..|..::..   |.:::.|:|.:..    .|..|:|| 
Human     4 PRRVSQLLDLCLWCFMKNISRYLTDIKPLPPNIKDR---LIKIMSMQGQITD----SNISEILHP 61

  Fly   189 LIGTYE--KCEEEEEEIYEVINVHKLK----SATPNLRV-INLYGINFI---------------- 230
            .:.|.:  .|:..:..:..:.|..|||    :|:...|| :...||..:                
Human    62 EVQTLDLRSCDISDAALLHLSNCRKLKKLNLNASKGNRVSVTSEGIKAVASSCSYLHEASLKRCC 126

  Fly   231 --DDSHIDAFSSNCIQLECLAVNFCNKVTGSTLKTLIQRSKRLTCLLMNGTSLKSEFVMQAEWDK 293
              .|..:.|.:.||..|:.:.:..|..:|..:|..|.:....|.|:..:.|.:....|:......
Human   127 NLTDEGVVALALNCQLLKIIDLGGCLSITDVSLHALGKNCPFLQCVDFSATQVSDSGVIALVSGP 191

  Fly   294 CA--LQELD----ITATDLSTECLVDMLSRIPSLKFLSAGQINGFNDSVLKQ 339
            ||  |:|:.    :..||.:.|.::....:|..|.|.....|...:..||:|
Human   192 CAKKLEEIHMGHCVNLTDGAVEAVLTYCPQIRILLFHGCPLITDHSREVLEQ 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689
leucine-rich repeat 131..156 CDD:275381 5/28 (18%)
leucine-rich repeat 157..175 CDD:275381 3/17 (18%)
leucine-rich repeat 219..244 CDD:275381 8/43 (19%)
leucine-rich repeat 245..270 CDD:275381 5/24 (21%)
leucine-rich repeat 271..295 CDD:275381 4/23 (17%)
leucine-rich repeat 296..320 CDD:275381 6/27 (22%)
leucine-rich repeat 321..348 CDD:275381 6/19 (32%)
leucine-rich repeat 349..375 CDD:275381
leucine-rich repeat 376..403 CDD:275381
leucine-rich repeat 405..432 CDD:275381
AMN1NP_001106873.1 AMN1 37..257 CDD:187754 45/214 (21%)
leucine-rich repeat 63..86 CDD:275381 3/22 (14%)
leucine-rich repeat 87..116 CDD:275381 7/28 (25%)
leucine-rich repeat 117..142 CDD:275381 4/24 (17%)
leucine-rich repeat 143..168 CDD:275381 5/24 (21%)
leucine-rich repeat 169..195 CDD:275381 6/25 (24%)
leucine-rich repeat 196..221 CDD:275381 5/24 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.