DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and B0564.6

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_502527.1 Gene:B0564.6 / 182046 WormBaseID:WBGene00007206 Length:423 Species:Caenorhabditis elegans


Alignment Length:295 Identity:69/295 - (23%)
Similarity:119/295 - (40%) Gaps:73/295 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LSDGTVRSPFADTTIEKLPDKV----LLHIFSYLSHREICRLAR-----ICRRWRQIAY------ 69
            :|.|.:.| |.|     |||.:    :.:.....|..::..:.|     :.::.|::.|      
 Worm   116 ISPGAIGS-FGD-----LPDSIEEISITNSMIECSEWDVATIIRKSFGTLLKKCRKLRYFEISGQ 174

  Fly    70 ---------DTRLWKNVSLRPEVSGLHVGSLEMLLQLISVRF--GPTLRYIELPIELITHTVLHE 123
                     |.::.:.:|...|...:.||.   .|.:.|:.|  ...|:.:.|....|:...|..
 Worm   175 CLMNSHFHVDPKILQFISNTVEHLAIAVGH---SLTINSLAFLKDKRLKTLNLQRSFISPCDLEH 236

  Fly   124 LSAKCPNLTHMLLDFSTAMQLHDFSEMQAFPTKLRYMCVCLSEVIFMEGFMRKIYNFINGL--EV 186
            :.|....:||  ||.|.::.|.|              |..::|::.:.....|  |...|:  :.
 Worm   237 IVAMADTITH--LDLSRSVNLLD--------------CRQIAELVNLRHLSLK--NNKEGVRDDS 283

  Fly   187 LHLIGTYEKCEEEEE---EIYEVINVHKLKSA--TPNLRVINLYGINFIDDSHIDAFSSNCIQLE 246
            |.||  .:.|.:.||   :..|.:.|:.|.:.  ..||:.::|.||..:||| :....|.|.:|.
 Worm   284 LQLI--IKNCSKLEELSLDCCEYLTVNSLITLGNLNNLKQLSLPGIVNVDDS-VCLQISRCSKLT 345

  Fly   247 CLAVNFCNKVTGSTLKTLIQRSKRLTCLLMNGTSL 281
            .|.:|||.:|          :.:.|.|||...|||
 Worm   346 YLNINFCRRV----------QKRGLLCLLSCLTSL 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 9/69 (13%)
leucine-rich repeat 131..156 CDD:275381 7/24 (29%)
leucine-rich repeat 157..175 CDD:275381 2/17 (12%)
leucine-rich repeat 219..244 CDD:275381 9/24 (38%)
leucine-rich repeat 245..270 CDD:275381 6/24 (25%)
leucine-rich repeat 271..295 CDD:275381 7/11 (64%)
leucine-rich repeat 296..320 CDD:275381
leucine-rich repeat 321..348 CDD:275381
leucine-rich repeat 349..375 CDD:275381
leucine-rich repeat 376..403 CDD:275381
leucine-rich repeat 405..432 CDD:275381
B0564.6NP_502527.1 leucine-rich repeat 106..130 CDD:275381 7/19 (37%)
leucine-rich repeat 131..159 CDD:275381 2/27 (7%)
leucine-rich repeat 166..193 CDD:275381 2/26 (8%)
leucine-rich repeat 195..214 CDD:275381 5/21 (24%)
leucine-rich repeat 219..243 CDD:275381 5/23 (22%)
leucine-rich repeat 244..266 CDD:275381 9/37 (24%)
leucine-rich repeat 267..293 CDD:275381 7/29 (24%)
leucine-rich repeat 294..318 CDD:275381 5/23 (22%)
leucine-rich repeat 319..343 CDD:275381 9/24 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.