DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and B0393.3

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_497980.1 Gene:B0393.3 / 175630 WormBaseID:WBGene00007168 Length:621 Species:Caenorhabditis elegans


Alignment Length:449 Identity:91/449 - (20%)
Similarity:170/449 - (37%) Gaps:118/449 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LSDGTVRSPFADTTIEKLPDKVLLHIFSYLSHREICRLARIC-------RRWRQIAYDTRLWKNV 77
            |||...||.   .::|.|.|::           :.|..|:|.       :..:.:.||  |:::.
 Worm    66 LSDSVKRSV---KSVEFLRDEL-----------DYCDDAKISFFLAVYGKNVQHMNYD--LFRSC 114

  Fly    78 SLRPEVSGLHVGSLEMLLQLISVRFGPTLRYIELPIELITHTV----LHELSAKCPNLTHMLLDF 138
            |||.........|:     :.||...|.|:.:::.| ...|.:    |..:..:|..|..:.:| 
 Worm   115 SLREYTQWSWRQSV-----ISSVTRCPQLKQLDILI-CCRHRLRDGDLQVIFKQCNQLEELRMD- 172

  Fly   139 STAMQLHDFSEMQAFPTKLRYMCVCLSEVIFMEGFMRKIYNFINGLEVLHLIGTYEKCEEEEEEI 203
            ::.:..|.||:......||...| |  :.:..:||:........ |:.||:  :..:| .:|:.|
 Worm   173 ASYINGHCFSKAPQTLRKLELEC-C--QTLNKQGFIGMCSRLFK-LQTLHV--SLMQC-IDEQLI 230

  Fly   204 YEVINVHKLKS----ATPN----------------LRVINLYGINFIDDSHIDAFSSNCI----- 243
            ..:.::..||:    |.|:                |..:.|.|:|.:.|..:...|....     
 Worm   231 KRIGDMKSLKNLSVVADPDQKMNQFRLAEIRRLSKLTTLCLDGVNNVTDKFLGDLSDLSTSPAGS 295

  Fly   244 QLECLAVNFCNKVTG---STLKTLIQRSKRLTCLLMNGTSLKSEFVMQAEWDKCALQELDITATD 305
            .:|.|:::||..:..   |.||||    ..|..|.::|.|.:                      |
 Worm   296 SIEHLSLSFCKNIGSNGISKLKTL----PNLKSLNLDGVSKR----------------------D 334

  Fly   306 LSTECLVDMLSRIPSLKFLSAGQINGFNDSVLKQWMESGTTRSLISLDLDSSDNISDEGLLKFIQ 370
            :||.  ::.:.:...|:.|...:....|...:.:::  .|..||.:||:..:..:.|:...:.: 
 Worm   335 ISTG--LEAIGQAGRLERLLVSEDTYVNPKTIAEFV--NTCESLRTLDISGNHRLKDKSFAEQV- 394

  Fly   371 RQGHQLSACCLS-GMPHI--TD--QLWMSILPLLGNCKIIVMGT--------AEKLGVN 416
                 .||...| |.|.:  ||  .:|..:.|.....::.::..        .|.|.||
 Worm   395 -----YSARAFSFGKPMVILTDFKSMWRQLPPFSYQSRVEIVNINDRYPEEYVESLSVN 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 10/52 (19%)
leucine-rich repeat 131..156 CDD:275381 5/24 (21%)
leucine-rich repeat 157..175 CDD:275381 5/17 (29%)
leucine-rich repeat 219..244 CDD:275381 6/29 (21%)
leucine-rich repeat 245..270 CDD:275381 9/27 (33%)
leucine-rich repeat 271..295 CDD:275381 4/23 (17%)
leucine-rich repeat 296..320 CDD:275381 3/23 (13%)
leucine-rich repeat 321..348 CDD:275381 4/26 (15%)
leucine-rich repeat 349..375 CDD:275381 4/25 (16%)
leucine-rich repeat 376..403 CDD:275381 9/31 (29%)
leucine-rich repeat 405..432 CDD:275381 4/20 (20%)
B0393.3NP_497980.1 leucine-rich repeat 103..137 CDD:275381 9/40 (23%)
leucine-rich repeat 138..165 CDD:275381 5/27 (19%)
leucine-rich repeat 188..213 CDD:275381 6/27 (22%)
leucine-rich repeat 214..265 CDD:275381 10/53 (19%)
LRR 232..>389 CDD:227223 35/186 (19%)
AMN1 <262..408 CDD:187754 36/181 (20%)
leucine-rich repeat 266..296 CDD:275381 6/29 (21%)
leucine-rich repeat 297..321 CDD:275381 9/27 (33%)
leucine-rich repeat 348..373 CDD:275381 4/26 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.