DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and FBXO39

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_694962.1 Gene:FBXO39 / 162517 HGNCID:28565 Length:442 Species:Homo sapiens


Alignment Length:368 Identity:81/368 - (22%)
Similarity:132/368 - (35%) Gaps:142/368 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LPDKVLLHIFSYLSHREICRLARICRRWRQIAYDTRLWK----NVSLRPEVSGLHVGSLEMLLQL 97
            |||..|..:|.:|..|:..|.|.:||:|.|:.|...||:    ..|.||  |.:|...:|..:..
Human    19 LPDLCLCRVFWWLGDRDRSRAALVCRKWNQMMYSAELWRYRTITFSGRP--SRVHASEVESAVWY 81

  Fly    98 ISVRFGPTLRYIELPIELITHTVLHELSAKCPNLTHMLLDFSTAMQLHDFSEMQAFPTKLRYMCV 162
            :. :||   ||:|                      |:.:.|   |..::....:.|...:|.:..
Human    82 VK-KFG---RYLE----------------------HLEVKF---MNPYNAVLTKKFQVTMRGLLS 117

  Fly   163 CLSE---------VIFME------------GFMRKIYNFI----NGLEVLHLIG---TYEK-CE- 197
            |||:         :.::|            .|:..:..|:    ..|:.|:|.|   |.|: |: 
Human   118 CLSKSNNRLKSLSIQYLELDRLVWRNSIRSSFISSLSFFLKKMGKRLDYLNLKGARLTVEQGCQI 182

  Fly   198 ------EEEEEIYEVINVH----------------KLKSATPNLRVINLYGINFIDDSHIDAFSS 240
                  ...|.:...:|:.                |..|...||..:||   |:           
Human   183 LDSLSYMRNENVISELNIEDYFSHHLAVYNSPQFKKTMSTFHNLVSLNL---NY----------- 233

  Fly   241 NCIQLECLAVNFCNKVTGSTLKTLIQRSKRLTC-----------------LLMNGTSLKSEFVMQ 288
            |||..|.|. |.|.  ..|||:|:     .:.|                 |....|:||..|..:
Human   234 NCISDELLE-NLCE--NASTLRTI-----NIKCHVHDPHGQVIWGMSWAKLARQATNLKVNFFFE 290

  Fly   289 --AEWDKCA---LQELDITATDLST------EC-----LVDML 315
              .::::.|   |||:.|.:..|.:      :|     |:|:|
Human   291 RIMKYERLARILLQEIPIRSISLRSCYFSDPDCSMRPTLIDLL 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 17/46 (37%)
leucine-rich repeat 131..156 CDD:275381 4/24 (17%)
leucine-rich repeat 157..175 CDD:275381 6/38 (16%)
leucine-rich repeat 219..244 CDD:275381 6/24 (25%)
leucine-rich repeat 245..270 CDD:275381 8/24 (33%)
leucine-rich repeat 271..295 CDD:275381 6/42 (14%)
leucine-rich repeat 296..320 CDD:275381 9/31 (29%)
leucine-rich repeat 321..348 CDD:275381
leucine-rich repeat 349..375 CDD:275381
leucine-rich repeat 376..403 CDD:275381
leucine-rich repeat 405..432 CDD:275381
FBXO39NP_694962.1 F-box-like 16..57 CDD:289689 15/37 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.