Sequence 1: | NP_733291.1 | Gene: | FipoQ / 43475 | FlyBaseID: | FBgn0039667 | Length: | 515 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_694962.1 | Gene: | FBXO39 / 162517 | HGNCID: | 28565 | Length: | 442 | Species: | Homo sapiens |
Alignment Length: | 368 | Identity: | 81/368 - (22%) |
---|---|---|---|
Similarity: | 132/368 - (35%) | Gaps: | 142/368 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 37 LPDKVLLHIFSYLSHREICRLARICRRWRQIAYDTRLWK----NVSLRPEVSGLHVGSLEMLLQL 97
Fly 98 ISVRFGPTLRYIELPIELITHTVLHELSAKCPNLTHMLLDFSTAMQLHDFSEMQAFPTKLRYMCV 162
Fly 163 CLSE---------VIFME------------GFMRKIYNFI----NGLEVLHLIG---TYEK-CE- 197
Fly 198 ------EEEEEIYEVINVH----------------KLKSATPNLRVINLYGINFIDDSHIDAFSS 240
Fly 241 NCIQLECLAVNFCNKVTGSTLKTLIQRSKRLTC-----------------LLMNGTSLKSEFVMQ 288
Fly 289 --AEWDKCA---LQELDITATDLST------EC-----LVDML 315 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
FipoQ | NP_733291.1 | F-box-like | 34..80 | CDD:289689 | 17/46 (37%) |
leucine-rich repeat | 131..156 | CDD:275381 | 4/24 (17%) | ||
leucine-rich repeat | 157..175 | CDD:275381 | 6/38 (16%) | ||
leucine-rich repeat | 219..244 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 245..270 | CDD:275381 | 8/24 (33%) | ||
leucine-rich repeat | 271..295 | CDD:275381 | 6/42 (14%) | ||
leucine-rich repeat | 296..320 | CDD:275381 | 9/31 (29%) | ||
leucine-rich repeat | 321..348 | CDD:275381 | |||
leucine-rich repeat | 349..375 | CDD:275381 | |||
leucine-rich repeat | 376..403 | CDD:275381 | |||
leucine-rich repeat | 405..432 | CDD:275381 | |||
FBXO39 | NP_694962.1 | F-box-like | 16..57 | CDD:289689 | 15/37 (41%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |