DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and FBXL16

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_699181.2 Gene:FBXL16 / 146330 HGNCID:14150 Length:479 Species:Homo sapiens


Alignment Length:433 Identity:98/433 - (22%)
Similarity:165/433 - (38%) Gaps:99/433 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RSPFADTTIEKLPDKVLLHIFSYLSHREICRLARICRRWRQIAYDTRLWKNVSLRPEVSGLHVGS 90
            |.|.|      ..:|:|..:|.|.|..|.|.||::|:.||::.|..:.|  ..|.|.   ||...
Human    92 RPPLA------TDEKILNGLFWYFSACEKCVLAQVCKAWRRVLYQPKFW--AGLTPV---LHAKE 145

  Fly    91 LEMLL-----QLISVRFGPTLRYIE---------LPI-ELITHTVLHELSAKCPNLTH------- 133
            |..:|     :.:::: |...|..|         |.| |.|.:..|.:...|..:|..       
Human   146 LYNVLPGGEKEFVNLQ-GFAARGFEGFCLVGVSDLDICEFIDNYALSKKGVKAMSLKRSTITDAG 209

  Fly   134 ---MLLDFSTAMQL-----HDFSEMQAFPT-KLRYMCVCLSEVI-----FMEGFMRKIYNFIN-G 183
               ||......::|     :||:|...:.: ..|...:.:|:.|     .:....:.:.|... .
Human   210 LEVMLEQMQGVVRLELSGCNDFTEAGLWSSLSARITSLSVSDCINVADDAIAAISQLLPNLAELS 274

  Fly   184 LEVLHLIGT---YEKCEEEEE-------EIYEVIN------VHKLKSATPNLRVINLYGINFIDD 232
            |:..|:..|   |....:...       ..:|:.|      ||.|    |||..::|.|.:.:.|
Human   275 LQAYHVTDTALAYFTARQGHSTHTLRLLSCWEITNHGVVNVVHSL----PNLTALSLSGCSKVTD 335

  Fly   233 SHIDAFSSNCIQLECLAVNFCNKVTGSTLKTLIQRSKRLTCLLMNGTSLKSEFVMQAEWDKCALQ 297
            ..::..:.|..:|..|.:::|.::|...|:.:.....||..|::               |:|   
Human   336 DGVELVAENLRKLRSLDLSWCPRITDMALEYVACDLHRLEELVL---------------DRC--- 382

  Fly   298 ELDITATDLSTECLVDMLSRIPSLKFLSAGQINGFNDSVLKQWMESGTTRSLISLDLDSSDNISD 362
             :.||.|.||   .:..:|.:.||......|:..|.   ||..:..|   ||..|.|.....::.
Human   383 -VRITDTGLS---YLSTMSSLRSLYLRWCCQVQDFG---LKHLLALG---SLRLLSLAGCPLLTT 437

  Fly   363 EGLLKFIQRQGHQLSACCLSGMPHITDQLWMSILPLLGNCKII 405
            .||...:|.|  :|....|:..|..|.:|:......|..|.:|
Human   438 TGLSGLVQLQ--ELEELELTNCPGATPELFKYFSQHLPRCLVI 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 14/45 (31%)
leucine-rich repeat 131..156 CDD:275381 7/40 (18%)
leucine-rich repeat 157..175 CDD:275381 3/22 (14%)
leucine-rich repeat 219..244 CDD:275381 5/24 (21%)
leucine-rich repeat 245..270 CDD:275381 5/24 (21%)
leucine-rich repeat 271..295 CDD:275381 3/23 (13%)
leucine-rich repeat 296..320 CDD:275381 6/23 (26%)
leucine-rich repeat 321..348 CDD:275381 6/26 (23%)
leucine-rich repeat 349..375 CDD:275381 7/25 (28%)
leucine-rich repeat 376..403 CDD:275381 6/26 (23%)
leucine-rich repeat 405..432 CDD:275381 1/1 (100%)
FBXL16NP_699181.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62
AMN1 201..413 CDD:332986 45/237 (19%)
leucine-rich repeat 220..243 CDD:275381 4/22 (18%)
leucine-rich repeat 244..269 CDD:275381 2/24 (8%)
LRR 1 244..266 2/21 (10%)
LRR 2 267..290 5/22 (23%)
leucine-rich repeat 270..295 CDD:275381 4/24 (17%)
leucine-rich repeat 296..321 CDD:275381 5/28 (18%)
LRR 3 319..343 7/27 (26%)
leucine-rich repeat 322..347 CDD:275381 5/24 (21%)
LRR 4 345..369 5/23 (22%)
leucine-rich repeat 348..373 CDD:275381 5/24 (21%)
LRR 5 371..395 10/45 (22%)
leucine-rich repeat 374..398 CDD:275381 9/45 (20%)
LRR 6 396..420 7/26 (27%)
LRR 7 446..470 6/25 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.