DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment FipoQ and LOC110437745

DIOPT Version :9

Sequence 1:	NP_733291.1	Gene:	FipoQ / 43475	FlyBaseID:	FBgn0039667	Length:	515	Species:	Drosophila melanogaster
Sequence 2:	XP_021323868.1	Gene:	LOC110437745 / 110437745	-ID:	-	Length:	579	Species:	Danio rerio

Alignment Length:	104	Identity:	28/104 - (26%)
Similarity:	46/104 - (44%)	Gaps:	14/104 - (13%)

- Green bases have known domain annotations that are detailed below.

  Fly    42 LLHIFSYLSHREICRLARICRRWRQIAYDTRLWKNVSLRPE--VSGLHVGSLEMLLQLISVRFGP 104
            ||.:|.....|.||   .||     :..:.|....||::.|  :....:|.:|:.||:...|...
Zfish   162 LLEVFCRTDQRCIC---AIC-----VLEEHRTHTTVSVQTERALKQRLLGKMELELQVCVDRRSA 218

  Fly   105 TLRYIELPIELITHTVLHELSAKCPNLTHMLLDFSTAMQ 143
            .|  .||..:|:  ||.....|:...:..:|.|.|:::|
Zfish   219 QL--AELKTKLL--TVQRYSQAEQAEVEQLLSDMSSSIQ 253

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
FipoQ	NP_733291.1	F-box-like	34..80	CDD:289689	11/37 (30%)
		leucine-rich repeat	131..156	CDD:275381	4/13 (31%)
		leucine-rich repeat	157..175	CDD:275381
		leucine-rich repeat	219..244	CDD:275381
		leucine-rich repeat	245..270	CDD:275381
		leucine-rich repeat	271..295	CDD:275381
		leucine-rich repeat	296..320	CDD:275381
		leucine-rich repeat	321..348	CDD:275381
		leucine-rich repeat	349..375	CDD:275381
		leucine-rich repeat	376..403	CDD:275381
		leucine-rich repeat	405..432	CDD:275381
LOC110437745	XP_021323868.1	RAD18	8..>99	CDD:333230
		RING_Ubox	10..53	CDD:327409
		zf-B_box	152..191	CDD:306989	10/36 (28%)
		SMC_N	<213..>393	CDD:330553	12/45 (27%)
		SPRY_PRY_C-I_1	407..575	CDD:293968
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C170588049
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.930