DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and LOC101731571

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:XP_012815591.1 Gene:LOC101731571 / 101731571 -ID:- Length:224 Species:Xenopus tropicalis


Alignment Length:249 Identity:39/249 - (15%)
Similarity:91/249 - (36%) Gaps:64/249 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 HKLKSATPNLRVINLYGINFIDDSHIDAFSSNCIQLECLAVNFCNKVTGS----TLK-----TLI 265
            |.|:....|..:::       |:..:...:...::||.|.::..::..|.    |:|     .||
 Frog    20 HGLRELALNYHLLS-------DELLLALSTEKHVRLEHLRIDVVSENPGQTQFHTIKKQSWDALI 77

  Fly   266 QRSKRLTCLLMNGTSLKSEFVMQAEWDKCALQELDITATDLSTECLVDMLSRI----PSL--KFL 324
            :.|.::..::.       .|:.:.|:|....:|..:|...........||.||    |.|  ..:
 Frog    78 KHSPKVNIVMY-------FFLYEEEFDAFFREETPVTHLYFGRAVSKAMLGRIGMNCPHLIELVV 135

  Fly   325 SAGQINGFNDSVLKQWMESGTTRSLISLDLDSSDNISDEGLLKFIQRQGHQLSACCLSGMPHITD 389
            ....:...:|.:::   .:...::|.|:.|...: :|....::|::..|.:|:...:.....|.|
 Frog   136 CTNGLQPLDDELIR---IADRCKNLTSIGLGECE-VSCSAFVEFVKMCGRRLTQLSIMEEVLIPD 196

  Fly   390 QLWMSILPLLGNCKIIVMGTAEKLGVNIHVDQLMDTIASNCGNLERLELRWDPD 443
            ..:                         :::|:...::.:.|.:      |.||
 Frog   197 NKY-------------------------NLEQIHYEVSKHLGRM------WFPD 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689
leucine-rich repeat 131..156 CDD:275381
leucine-rich repeat 157..175 CDD:275381
leucine-rich repeat 219..244 CDD:275381 1/24 (4%)
leucine-rich repeat 245..270 CDD:275381 9/33 (27%)
leucine-rich repeat 271..295 CDD:275381 3/23 (13%)
leucine-rich repeat 296..320 CDD:275381 6/27 (22%)
leucine-rich repeat 321..348 CDD:275381 2/28 (7%)
leucine-rich repeat 349..375 CDD:275381 6/25 (24%)
leucine-rich repeat 376..403 CDD:275381 3/26 (12%)
leucine-rich repeat 405..432 CDD:275381 1/26 (4%)
LOC101731571XP_012815591.1 leucine-rich repeat 22..47 CDD:275381 3/31 (10%)
leucine-rich repeat 48..82 CDD:275381 9/33 (27%)
AMN1 <114..>188 CDD:187754 14/77 (18%)
leucine-rich repeat 130..156 CDD:275381 2/28 (7%)
leucine-rich repeat 157..182 CDD:275381 6/25 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.