DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and fbxl18

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:XP_002931545.1 Gene:fbxl18 / 100492578 XenbaseID:XB-GENE-980052 Length:692 Species:Xenopus tropicalis


Alignment Length:484 Identity:102/484 - (21%)
Similarity:175/484 - (36%) Gaps:138/484 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KLPDKVLLHIFSYLSHRE-ICRLARICRRWRQIAYDTRLWKNVSLRPEVSGLHVGSLEMLLQLIS 99
            :|.|::||||.||:...: |..:.|.|.:...:..|..|.:.|.|..|    :..|...:.||:.
 Frog     5 ELSDEILLHILSYVPSTDLILNVKRTCHKLAGLCLDKSLIQKVILHKE----YQASDNQVKQLLR 65

  Fly   100 VRFGPTLRYIELP--IELITHTVLHELSAKCPNLTHMLLDFS----TAMQLHDFSEMQAFPTKLR 158
             ..|..:|.:::.  ..|.:.||  :|.|:|..|..  ||.|    |:::|      ....|.|.
 Frog    66 -EAGKEIRELDMSGCYWLSSSTV--DLIAQCKRLVR--LDLSGCPLTSLRL------SKLLTDLH 119

  Fly   159 YMCVCLSEVIFMEGFMRKIYNFINGLEVLHLIGTYEKCEEEEEEIYEVINVHKLKSATPNLRVIN 223
            .:|....::    |     ..|.:|........|.....|.::.::           .|:..|:.
 Frog   120 QLCSLSIDI----G-----AGFDSGQLTTECKATLRHVRELKQTLF-----------APSYGVVP 164

  Fly   224 LYGINFIDDSHIDAFSSNCIQLECLAVNFCNKVTGSTLKTLIQRSKRLTCLLMNGTSLKSEFVMQ 288
            .                 ||.||.|.:.|          .::.|::..|  :|:|..:..|    
 Frog   165 C-----------------CINLEKLLLYF----------EVLDRTREGT--VMSGQLMVGE---- 196

  Fly   289 AEWDKCALQELDITATDLSTECLVDMLSRIP---SLKFLSAGQINGF-NDSVLKQWMESGTTRS- 348
                                       |:||   :|:...|....|: |:.|::.::...|.|: 
 Frog   197 ---------------------------SKIPHYQNLRLFYARLAPGYINEEVVRLYLTVLTDRTP 234

  Fly   349 ------LISL-----DLDSSDNISDEGLLKFIQRQGHQLSACCLSGMPHITDQLWMSILPLLGNC 402
                  |||:     :..:|.|:.| .:.|.:..:..||....|||...:.:..:.|...|..:.
 Frog   235 ENLRAFLISVPGSLAESSASKNLLD-SMAKNVSLEAFQLPKSWLSGSSLLQNLKFSSPFYLSFSR 298

  Fly   403 KIIVMGTAEKLGVNIHVDQLMDTIASNCGNLERLELRWDPDNLRFSD----KSQKAID-----IL 458
            .:|..|...:..:|.|:|         |.:|..|.||..|.:|. ||    |:.:.||     .|
 Frog   299 SMISGGQLTQWVINGHMD---------CRSLVSLNLRGCPFSLN-SDLPFRKTVEDIDCNILETL 353

  Fly   459 RVKCLKLRCMVLSDGRYYETVKANFERAD 487
            ...|..|..:.||...::.:..|.....|
 Frog   354 VTACPNLAHLNLSYAHHHSSESATRHLCD 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 14/44 (32%)
leucine-rich repeat 131..156 CDD:275381 6/28 (21%)
leucine-rich repeat 157..175 CDD:275381 3/17 (18%)
leucine-rich repeat 219..244 CDD:275381 2/24 (8%)
leucine-rich repeat 245..270 CDD:275381 5/24 (21%)
leucine-rich repeat 271..295 CDD:275381 4/23 (17%)
leucine-rich repeat 296..320 CDD:275381 3/26 (12%)
leucine-rich repeat 321..348 CDD:275381 6/27 (22%)
leucine-rich repeat 349..375 CDD:275381 7/30 (23%)
leucine-rich repeat 376..403 CDD:275381 6/26 (23%)
leucine-rich repeat 405..432 CDD:275381 6/26 (23%)
fbxl18XP_002931545.1 F-box-like 8..43 CDD:372399 11/34 (32%)
leucine-rich repeat 18..43 CDD:275381 4/24 (17%)
leucine-rich repeat 44..68 CDD:275381 6/28 (21%)
leucine-rich repeat 71..95 CDD:275381 7/25 (28%)
leucine-rich repeat 96..120 CDD:275381 8/31 (26%)
leucine-rich repeat 320..359 CDD:275381 13/39 (33%)
leucine-rich repeat 360..389 CDD:275381 5/23 (22%)
leucine-rich repeat 459..506 CDD:275381
leucine-rich repeat 507..533 CDD:275381
leucine-rich repeat 534..563 CDD:275381
leucine-rich repeat 564..589 CDD:275381
leucine-rich repeat 590..616 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.