DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and fbxl4

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:XP_031761765.1 Gene:fbxl4 / 100490265 XenbaseID:XB-GENE-961513 Length:622 Species:Xenopus tropicalis


Alignment Length:397 Identity:88/397 - (22%)
Similarity:154/397 - (38%) Gaps:114/397 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LSDGTVRSPFADTTIEKLPDKVLLHIFSYLSHREICRLARICRRWRQIAYDTRLWKNVSLRPEVS 84
            ||:..:|....:...:|||.:::..|.|:|:..::||||:.|:...|...|...:.::||:|..:
 Frog   267 LSNTGIREWTNNGYFDKLPYELIQFIISHLALPDLCRLAQTCKLMYQHCCDPLQYTHLSLQPYWT 331

  Fly    85 GLHVGSLEMLL--------------------------QLISVRFGPTLRYIELPI-ELITHTVLH 122
            .::..|||.||                          :|:.| .|..|..:||.. ..:....|.
 Frog   332 NVNDNSLEYLLPRCSLVQWLNLSWTGNRGLISTSGFSRLLKV-CGSELVRLELACGHFLNEACLE 395

  Fly   123 ELSAKCPNLTHMLLDFSTAMQLHDFSEMQAFPTKLRYMCVCLSEVIFMEGFMRKIYNFINGLEVL 187
            .::..||||..  |:.|:..:|.        |....::|.                  ::||:.|
 Frog   396 VIAEMCPNLQE--LNLSSCDKLP--------PQAFSHICK------------------LSGLKRL 432

  Fly   188 HLIGTYEKCEEEEEEIYEVINVHKLKSATPNLRVINLYGINFIDDSHIDA--FSSNCIQLECLAV 250
            .|..|    :.|:..:..::|.      .|.::.:||.....|:|..:.|  ..:.|.:|..|.:
 Frog   433 VLYRT----KIEQTALLSILNF------CPEIQHLNLGSCVLIEDYDLVASVLGAKCKKLRSLDL 487

  Fly   251 NFCNKVTGSTLKTLIQRSKRLTCLLMNGTSLKSEFVMQAEWDKCALQELDI---TATDLSTECLV 312
            ..|..:|...:..|..     .|||                    |:|||:   .....||.|.|
 Frog   488 WRCKNITERGIAELAS-----GCLL--------------------LEELDLGWCPTLQSSTGCFV 527

  Fly   313 DMLSRIPSLK--FLSAGQINGFNDSVLKQWME--SGTTRSLISLDLDSSDNISDEGLLKFIQRQG 373
            ::.|::|:|:  ||:|      |.||....:|  :...:.|..||:..:..:|...|.|.::   
 Frog   528 NLASKLPNLRKLFLTA------NRSVCDSDIEELARNCQHLQQLDILGTRMVSPAALCKLLE--- 583

  Fly   374 HQLSACC 380
                 ||
 Frog   584 -----CC 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 14/45 (31%)
leucine-rich repeat 131..156 CDD:275381 5/24 (21%)
leucine-rich repeat 157..175 CDD:275381 1/17 (6%)
leucine-rich repeat 219..244 CDD:275381 6/26 (23%)
leucine-rich repeat 245..270 CDD:275381 5/24 (21%)
leucine-rich repeat 271..295 CDD:275381 3/23 (13%)
leucine-rich repeat 296..320 CDD:275381 9/26 (35%)
leucine-rich repeat 321..348 CDD:275381 8/30 (27%)
leucine-rich repeat 349..375 CDD:275381 6/25 (24%)
leucine-rich repeat 376..403 CDD:275381 2/5 (40%)
leucine-rich repeat 405..432 CDD:275381
fbxl4XP_031761765.1 F-box-like 281..325 CDD:403981 13/43 (30%)
leucine-rich repeat 296..318 CDD:275381 7/21 (33%)
leucine-rich repeat 319..341 CDD:275381 6/21 (29%)
leucine-rich repeat 348..377 CDD:275381 3/29 (10%)
leucine-rich repeat 378..403 CDD:275381 5/24 (21%)
leucine-rich repeat 404..428 CDD:275381 6/51 (12%)
AMN1 427..606 CDD:187754 48/208 (23%)
leucine-rich repeat 429..453 CDD:275381 6/33 (18%)
leucine-rich repeat 454..481 CDD:275381 6/26 (23%)
leucine-rich repeat 482..507 CDD:275381 6/29 (21%)
leucine-rich repeat 508..535 CDD:275381 9/26 (35%)
leucine-rich repeat 536..561 CDD:275381 8/30 (27%)
leucine-rich repeat 562..587 CDD:275381 8/32 (25%)
leucine-rich repeat 588..613 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.