DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and fbxl16

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001096414.1 Gene:fbxl16 / 100125019 XenbaseID:XB-GENE-5821642 Length:497 Species:Xenopus tropicalis


Alignment Length:426 Identity:99/426 - (23%)
Similarity:166/426 - (38%) Gaps:101/426 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LPDKVLLHIFSYLSHREICRLARICRRWRQIAYDTRLWKNVSLRPEVSG------LHVGSLEML- 94
            |.:|:|..:|.|.|..|.|.||::|:.||::.|.:|.|  :.|.|.:..      |..|..|.: 
 Frog   115 LDEKILTRLFCYFSACEKCILAQVCKTWRRVLYQSRFW--LGLTPVLHAKELYNVLPAGDKEFVN 177

  Fly    95 LQLISVRFGPTLRYI---ELPI-ELITHTVLHELSAKCPNLTH----------MLLDFSTAMQL- 144
            ||..:||...:...:   :|.| |.|.:..|.:...|..:|..          ||......::| 
 Frog   178 LQGFAVRGFESFCLVGVSDLDICEFIDNYPLSKKGVKSVSLKRSTITDAGLEVMLEQMQGVVRLE 242

  Fly   145 ----HDFSE------MQAFPTKLRYM-CV--------CLSEVIFMEGFMRKIYNFINGLEVLHLI 190
                :||:|      :....|.|... |:        .:|:::...|.:        .|:..|:.
 Frog   243 LSGCNDFTEAGLWSSLHGRITSLSVSDCINVADDAVAAISQLLPNLGEL--------NLQAYHVT 299

  Fly   191 GT---YEKCEEEE-------EEIYEVIN------VHKLKSATPNLRVINLYGINFIDDSHIDAFS 239
            .|   |...::..       ...:|:.|      ||.|    |||.|::|.|.:.:.|..::..:
 Frog   300 DTALAYFTAKQGRATHTLRLHSCWEITNHGVVNVVHSL----PNLTVLSLSGCSKVTDDGVELVA 360

  Fly   240 SNCIQLECLAVNFCNKVTGSTLKTLIQRSKRLTCLLMNGTSLKSEFVMQAEWDKCALQELDITAT 304
            .|..:|..|.:::|.::|.:.|:.:.....:|..|::               |:|    :.||.|
 Frog   361 ENLRRLRGLDLSWCPRLTDTALEYIACDLHKLEELVL---------------DRC----VRITDT 406

  Fly   305 DLSTECLVDMLSRIPSLKFLSAGQINGFNDSVLKQWMESGTTRSLISLDLDSSDNISDEGLLKFI 369
            .||      .||.:|||..|.........|..||..:   ..:||..|.|.....::..||...:
 Frog   407 GLS------YLSTMPSLHSLYLRWCCQVQDFGLKHLL---AMKSLRLLSLAGCPLLTTTGLSGLV 462

  Fly   370 QRQGHQLSACCLSGMPHITDQLWMSILPLLGNCKII 405
            |.|  .|....|:..|..|.:|:......|..|.:|
 Frog   463 QLQ--DLEELELTNCPGATPELFKYFSQHLPRCVVI 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 16/42 (38%)
leucine-rich repeat 131..156 CDD:275381 7/45 (16%)
leucine-rich repeat 157..175 CDD:275381 4/26 (15%)
leucine-rich repeat 219..244 CDD:275381 6/24 (25%)
leucine-rich repeat 245..270 CDD:275381 5/24 (21%)
leucine-rich repeat 271..295 CDD:275381 3/23 (13%)
leucine-rich repeat 296..320 CDD:275381 7/23 (30%)
leucine-rich repeat 321..348 CDD:275381 5/26 (19%)
leucine-rich repeat 349..375 CDD:275381 7/25 (28%)
leucine-rich repeat 376..403 CDD:275381 6/26 (23%)
leucine-rich repeat 405..432 CDD:275381 1/1 (100%)
fbxl16NP_001096414.1 F-box 113..152 CDD:306992 15/36 (42%)
AMN1 <222..353 CDD:332986 26/142 (18%)
leucine-rich repeat 238..261 CDD:275381 4/22 (18%)
leucine-rich repeat 262..287 CDD:275381 4/24 (17%)
leucine-rich repeat 288..313 CDD:275381 5/32 (16%)
AMN1 297..476 CDD:332986 49/212 (23%)
leucine-rich repeat 314..339 CDD:275381 5/28 (18%)
leucine-rich repeat 340..365 CDD:275381 6/24 (25%)
leucine-rich repeat 366..391 CDD:275381 5/24 (21%)
leucine-rich repeat 392..416 CDD:275381 11/48 (23%)
leucine-rich repeat 417..436 CDD:275381 5/18 (28%)
leucine-rich repeat 442..466 CDD:275381 7/25 (28%)
leucine-rich repeat 467..492 CDD:275381 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.