DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2006 and DTWD1

DIOPT Version :9

Sequence 1:NP_001189310.1 Gene:CG2006 / 43472 FlyBaseID:FBgn0039664 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001138427.1 Gene:DTWD1 / 56986 HGNCID:30926 Length:304 Species:Homo sapiens


Alignment Length:302 Identity:108/302 - (35%)
Similarity:162/302 - (53%) Gaps:53/302 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PFVHMRIADHSALDTIE--GRHNCRLCNRSRKFFCYSCCVPVGELE-ELLPRLELPLQVDIIKHK 76
            |..::.:|....|...:  ||..|..|..||.|:||:|.|||..:. |.:|.::|||::|||||.
Human    35 PLQNLCLASQEVLQKAQQSGRSKCLKCGGSRMFYCYTCYVPVENVPIEQIPLVKLPLKIDIIKHP 99

  Fly    77 KEIDGKSSAVHAAVLAPAHVRIHTFPDIPDYRE-EAGVVLIFPSATALAVPQLFARNVQLQIGDN 140
            .|.||||:|:||.:|||..|.|:|:|.||:|.| :..|.||||...::::..: :.::|.:|.:|
Human   100 NETDGKSTAIHAKLLAPEFVNIYTYPCIPEYEEKDHEVALIFPGPQSISIKDI-SFHLQKRIQNN 163

  Fly   141 Y-GLPKGHHMGTMLRRRMDEVEVKELQEEVDEPETVRRTWTLDNLPVRRAVFIDSTWNQSRGIYA 204
            . |........:..|:|.:|.|..:|.:...:..|           :::.:||||||||:..|:.
Human   164 VRGKNDDPDKPSFKRKRTEEQEFCDLNDSKCKGTT-----------LKKIIFIDSTWNQTNKIFT 217

  Fly   205 DARVRGLRTVVLQNRLSQFWRHQRGSPRWYLATIEAIHQFLLEVHINAWGLNTAYRGLDNLEITA 269
            |.|::||..|.|:.|.:.|||||:|.|..:|:|||||:.||::.|.:.                 
Human   218 DERLQGLLQVELKTRKTCFWRHQKGKPDTFLSTIEAIYYFLVDYHTDI----------------- 265

  Fly   270 GFHQLAEPLTKTAASENVGREAPYNGQYDNLLFFFAHMYDLI 311
                |.|               .|.|||||||||::.||.||
Human   266 ----LKE---------------KYRGQYDNLLFFYSFMYQLI 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2006NP_001189310.1 DTW 44..312 CDD:281875 99/271 (37%)
DTWD1NP_001138427.1 DTW 66..289 CDD:397847 99/271 (37%)
DXTW 206..209 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160006
Domainoid 1 1.000 160 1.000 Domainoid score I4081
eggNOG 1 0.900 - - E1_KOG3795
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10633
Inparanoid 1 1.050 173 1.000 Inparanoid score I4078
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54886
OrthoDB 1 1.010 - - D601886at33208
OrthoFinder 1 1.000 - - FOG0006376
OrthoInspector 1 1.000 - - oto91700
orthoMCL 1 0.900 - - OOG6_104689
Panther 1 1.100 - - LDO PTHR15627
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3038
SonicParanoid 1 1.000 - - X5326
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.