DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2006 and dtwd1

DIOPT Version :9

Sequence 1:NP_001189310.1 Gene:CG2006 / 43472 FlyBaseID:FBgn0039664 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001017188.1 Gene:dtwd1 / 549942 XenbaseID:XB-GENE-944642 Length:294 Species:Xenopus tropicalis


Alignment Length:301 Identity:99/301 - (32%)
Similarity:161/301 - (53%) Gaps:56/301 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 HMRIADHSALDTIE--GRHNCRLCNRSRKFFCYSCCVPVGEL-EELLPRLELPLQVDIIKHKKEI 79
            :::::....|:..:  ||..|..||.||.|:||:|.|||..: .:.:|.::|||::|||||..|.
 Frog    35 NLKLSSQRVLEIAQKKGRSKCPKCNSSRMFYCYTCFVPVESVPSDEIPVVKLPLKIDIIKHPNET 99

  Fly    80 DGKSSAVHAAVLAPAHVRIHTFPDIPDYREEA-GVVLIF--PSATALAVPQLFARNVQLQIGDNY 141
            ||||:||||.:||...|.::|:|.:|.|:::. .|||:|  |.:.:|:...|:.|.......|:.
 Frog   100 DGKSTAVHAKLLAHEDVTVYTYPCVPQYQDQKHEVVLVFPGPDSVSLSDSLLYIRGSGDMQNDSS 164

  Fly   142 GLPKGHHMGTMLRRRMDEVEVKELQEEVDEPETVRRTWTLDNLPVRRAVFIDSTWNQSRGIYADA 206
            ..|      ::.|.:..:...|...|.|:|.:.:..        :::.:||||||||:..|.:|.
 Frog   165 CEP------SLKRPKCSQQYDKSKNEGVEEKKPMHF--------LKKLIFIDSTWNQTNKIISDE 215

  Fly   207 RVRGLRTVVLQNRLSQFWRHQRGSPRWYLATIEAIHQFLLEVHINAWGLNTAYRGLDNLEITAGF 271
            |::||:.|.|..|.:.|||||:|:|..||:|||||:.|:::.|                      
 Frog   216 RLQGLQQVELMERKTCFWRHQKGTPNTYLSTIEAIYYFMIDYH---------------------- 258

  Fly   272 HQLAEPLTKTAASENVGREAPYNGQYDNLLFFFAHMYDLIH 312
                          .:..:..|.|:||:|||||:.||.:|:
 Frog   259 --------------TIILQKDYKGEYDDLLFFFSFMYRIIN 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2006NP_001189310.1 DTW 44..312 CDD:281875 90/271 (33%)
dtwd1NP_001017188.1 DTW 63..281 CDD:377168 88/267 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..185 4/32 (13%)
DXTW 202..205 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 147 1.000 Domainoid score I4471
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10633
Inparanoid 1 1.050 164 1.000 Inparanoid score I4080
OMA 1 1.010 - - QHG54886
OrthoDB 1 1.010 - - D601886at33208
OrthoFinder 1 1.000 - - FOG0006376
OrthoInspector 1 1.000 - - otm49457
Panther 1 1.100 - - LDO PTHR15627
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3038
SonicParanoid 1 1.000 - - X5326
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1313.110

Return to query results.
Submit another query.