DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp99A and PTP1

DIOPT Version :9

Sequence 1:NP_651691.4 Gene:Ptp99A / 43469 FlyBaseID:FBgn0004369 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_010051.1 Gene:PTP1 / 851368 SGDID:S000002389 Length:335 Species:Saccharomyces cerevisiae


Alignment Length:300 Identity:90/300 - (30%)
Similarity:136/300 - (45%) Gaps:81/300 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   668 SQHPENKRKNRYLNITAYDHSRVHLHPTPGQKKNLDYINANFIDGYQKGHA-----FIGTQGPLP 727
            |..|.|..:|||:||..|:.:||||....|.    |||||:::.....|.:     :|.||||..
Yeast    47 SIEPRNDARNRYVNIMPYERNRVHLKTLSGN----DYINASYVKVNVPGQSIEPGYYIATQGPTR 107

  Fly   728 DTFDCFWRMIWEQ---RVAIIVMITNLVERGRRKCDMYWPKDGVETYGVIQVKLIEEEVMSTYTV 789
            .|:|.||:|.:..   ...:|||:|.|||..|.||..|||:.||:.                 ||
Yeast   108 KTWDQFWQMCYHNCPLDNIVIVMVTPLVEYNREKCYQYWPRGGVDD-----------------TV 155

  Fly   790 R-------------------TLQIKHLKLKKKKQCNT---------------EKLVYQYHYTNWP 820
            |                   .|:|:.:.:.|.|...|               .|.|:.:::..|.
Yeast   156 RIASKWESPGGANDMTQFPSDLKIEFVNVHKVKDYYTVTDIKLTPTDPLVGPVKTVHHFYFDLWK 220

  Fly   821 DHGTPDHPLPVLNFVKKSSAANPAEAGPIVVHCSAGVGRTGTYIVLDAMLKQ-IQQKNIVN---- 880
            |...|:..:|::.....|.:.| :...||:||||||||||||:|.||.::.. :..|||..    
Yeast   221 DMNKPEEVVPIMELCAHSHSLN-SRGNPIIVHCSAGVGRTGTFIALDHLMHDTLDFKNITERSRH 284

  Fly   881 ------------VFGFLRHIRAQRNFLVQTEEQYIFLHDA 908
                        :...:..:|:||..:|||::|::|::.|
Yeast   285 SDRATEEYTRDLIEQIVLQLRSQRMKMVQTKDQFLFIYHA 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp99ANP_651691.4 FN3 140..236 CDD:238020
fn3 249..331 CDD:278470
FN3 342..437 CDD:238020
FN3 442..520 CDD:238020
PTPc 646..911 CDD:214550 89/299 (30%)
PTPc 676..911 CDD:238006 86/291 (30%)
PTPc 935..1186 CDD:214550
PTPc 963..1169 CDD:238006
PTP1NP_010051.1 COG5599 1..335 CDD:227886 89/299 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I1104
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46470
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.